bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3076_orf2 Length=150 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1520 120 8e-27 > 5807.cgd4_1520 Length=353 Score = 120 bits (302), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 65/143 (45%), Positives = 87/143 (60%), Gaps = 18/143 (12%) Query 1 KELFMQVFGTPRNHPKSKPFFDHAMSFFVTDSRIWFRHYQIAPLVMGEGGDANDPHRQTF 60 K+LF+QVFGTPR HPKSKPF DH +SF D +IWFRHYQIAP D N+ +Q Sbjct 206 KDLFIQVFGTPRYHPKSKPFHDHVISFNFLDGKIWFRHYQIAPTT---ERDHNNVDKQVL 262 Query 61 IEIGPRFVLDPVKILEGSFCGKTLWRNGEFVRTRDLMRPRRLREVL------DFAKRQGQ 114 IEIGPRFVL+P+ IL+G+F G+ L+RN ++ P LR ++ + +R Sbjct 263 IEIGPRFVLEPILILDGTFSGQVLYRNPDY------KSPTLLRNIIKQGYSSSYLQRVQS 316 Query 115 KEKRRLY---LESMMEGEPRNKL 134 K+KR Y L+S + P K+ Sbjct 317 KQKRSDYKDDLDSSLMNVPEKKM 339 Lambda K H 0.325 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22764965652 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40