bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3127_orf1 Length=159 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_2470 141 5e-33 > 5807.cgd5_2470 Length=312 Score = 141 bits (356), Expect = 5e-33, Method: Compositional matrix adjust. Identities = 64/133 (48%), Positives = 93/133 (69%), Gaps = 0/133 (0%) Query 27 EFPKEGELVILYGSREMIISCVLRRAGILRTRLGNFSHEDIMKTRIGHKVYEQRQGKWLV 86 E K G+LV+L+G EM+I L + G +TR G F H +I+ G ++++ + KW+V Sbjct 44 EMCKNGDLVVLFGGYEMVIQVFLEQNGRTQTRNGVFLHNEIIGKNFGSRIFDTSKSKWMV 103 Query 87 VLRPTPDLHTLALRHRTQIIYHADISLILSLLDVRPGKTIVEAGTGSGSLSYSLAMALRP 146 VL+ +P+L +++L HRTQI+Y ADISLI LLD PGK I+EAGTGSGSL+ SL + P Sbjct 104 VLKLSPELISISLNHRTQILYQADISLICVLLDASPGKNIIEAGTGSGSLTVSLCRSTNP 163 Query 147 GGRLFTFEFHEQR 159 GG ++TFE+ ++R Sbjct 164 GGAVYTFEYDQKR 176 Lambda K H 0.323 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40