bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3147_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 5270.UM02461.1 82.4 3e-15 > 5270.UM02461.1 Length=508 Score = 82.4 bits (202), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 52/121 (42%), Positives = 65/121 (53%), Gaps = 34/121 (28%) Query 1 APSSCV--LAQGIEGLFKRNKVEYIKGAGRLADPHTVEVQPIGGGSTEKLKTKNIILATG 58 A SS V L +GIEGLFK+NKV+Y+KGAG + P T++V GG TE ++ KNII+ATG Sbjct 127 AKSSAVTGLTKGIEGLFKKNKVDYLKGAGSFSSPTTIKVALNDGGETE-IEAKNIIIATG 185 Query 59 SEAAPLVGGALEAVTCSRLSTKHLSSRTSRFQRLVFFCLCQVDEQQIVSSTGALALSSVP 118 SE P G ++DE+QIVSSTGAL L VP Sbjct 186 SEVTPFPG-------------------------------IEIDEKQIVSSTGALELQKVP 214 Query 119 R 119 Sbjct 215 E 215 Lambda K H 0.317 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40