bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3164_orf1 Length=184 Score E Sequences producing significant alignments: (Bits) Value 223283.PSPTO_2703 64.7 1e-09 > 223283.PSPTO_2703 Length=493 Score = 64.7 bits (156), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/88 (37%), Positives = 50/88 (56%), Gaps = 0/88 (0%) Query 8 VDIERYKEKIVERLGNGFLKDELDRVCQDGSNKFYNTTRKSILFLLNKQKNILKISIALA 67 +D+E YK+ ++ER N + D+L RVC DGS+KF T +I L+ Q N + S+ +A Sbjct 349 IDLEGYKDTLIERFSNQAIADQLARVCSDGSSKFPKFTVPTINRLIVDQGNFQRASLVVA 408 Query 68 AWILYFATDYVHGIPIIPSDPKAPELRG 95 AW LY +G+ DP+A +G Sbjct 409 AWALYLKGVDENGVTYTIPDPRAEFCQG 436 Lambda K H 0.322 0.139 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 39517472064 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40