bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3174_orf1 Length=107 Score E Sequences producing significant alignments: (Bits) Value 42254.ENSSARP00000004741 65.5 4e-10 > 42254.ENSSARP00000004741 Length=374 Score = 65.5 bits (158), Expect = 4e-10, Method: Composition-based stats. Identities = 37/62 (59%), Positives = 44/62 (70%), Gaps = 6/62 (9%) Query 50 EQNPADELVDYEEDEQQNDTKEKGVGEEAVGR----GNYVSIHASGFRDFLLKPELLRAI 105 E + +EL+DYEEDE + T G G EA + G+YVSIH+SGFRDFLLKPELLRAI Sbjct 3 ENDVDNELLDYEEDEVE--TAAGGDGTEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAI 60 Query 106 GD 107 D Sbjct 61 VD 62 Lambda K H 0.311 0.128 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40