bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3225_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 7227.CG14903-PA 108 7e-23 > 7227.CG14903-PA Length=119 Score = 108 bits (269), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 58/118 (49%), Positives = 76/118 (64%), Gaps = 7/118 (5%) Query 6 LVQYVVVRRDLTDALQWPLGAVVAQACHAAVDALGLAMDRNVEEARR--YLAEGSNMRTV 63 +VQY+VVR DL AL WPLGAV+AQ+CHA + L N E+A YL + NM V Sbjct 4 IVQYIVVRSDLRSALSWPLGAVIAQSCHATAAVIHL----NSEDADTVAYLNDLDNMHKV 59 Query 64 VLQVSGEGELLKLRDRLVQNHIEHKLWQEEPEKIPTALASVP-IRKSVGKVFKGLKLL 120 VL+ E L+KL ++L +N I+HKLW E+PE IPT +A P ++ +V K K LKLL Sbjct 60 VLEAKDESALVKLSEKLKENEIKHKLWIEQPENIPTCIALKPYVKDTVHKYVKHLKLL 117 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40