bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3250_orf2 Length=112 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_1630 82.0 4e-15 > 5807.cgd3_1630 Length=186 Score = 82.0 bits (201), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%) Query 2 LNVVQSGGTEERKGITLSAAESFDIPNSRGTANLIMRFDGSKQTATINVEQVKGVTRA-Y 60 ++ QS G+ ++ IT+ ES ++ NSRG N M+++ K+ +TI ++ ++R Sbjct 52 FDIEQSAGSLTKERITVDPNESIEMENSRGIVNFAMKWESDKRQSTITCIKLNNISRMKV 111 Query 61 TAEDSGKFVPIISFDCRGLEANNWLPTAGC-VVRGPKKSFIDVDLSE-DWADFD 112 T+ED GK VP+ +FDCRG+ W P+ G V+ K F +++L E +W DFD Sbjct 112 TSEDEGKLVPVAAFDCRGINLTKWNPSFGYNVISNSGKKFENINLEELEWCDFD 165 Lambda K H 0.315 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40