bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3305_orf2 Length=176 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0310 85.9 6e-16 > 5833.PF11_0310 Length=609 Score = 85.9 bits (211), Expect = 6e-16, Method: Composition-based stats. Identities = 43/144 (29%), Positives = 78/144 (54%), Gaps = 0/144 (0%) Query 30 FIKQFTSPYAICIVVYSIIKAIMYAFFTTAAENLLGKEVNDFMGAALPFSLFPCIVIGKV 89 IK FT + +C+ +Y + AI F+ + EN+L K+ ND +G LPFS PC+++G + Sbjct 414 LIKIFTCAHFLCLWIYGPLNAIYNTFYFSVVENILSKDKNDILGYILPFSFIPCVLLGNL 473 Query 90 VDMVGIMPILFFLNTCITLAYGFSMIPALPTAYFSALLYICYVSFYSSQSYCFVSDTFSS 149 D G+M + + Y FS I + + S + Y + + Q + F+S TFSS Sbjct 474 SDKFGVMLMFTYELIFAFSMYAFSYIKSNWAQWISVISNALYSACANGQLWTFISFTFSS 533 Query 150 SHFGKIVGTIHLLAGFLSLLKIPM 173 + ++G ++L+ G +S +++ + Sbjct 534 KYHSTLIGFLNLVCGVVSFVRLSL 557 Lambda K H 0.328 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40