bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3376_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 6239.C34G6.4 144 1e-33 > 6239.C34G6.4 Length=1265 Score = 144 bits (362), Expect = 1e-33, Method: Composition-based stats. Identities = 69/113 (61%), Positives = 87/113 (76%), Gaps = 0/113 (0%) Query 19 SEGQILFDGDDLRTLNVVSVRKQEGLVSQEPVLFDMTIEENIATSKPDATEEEIREAAKL 78 ++G++L DG DLR +NV S+R+Q G+VSQEPVLFD TI ENI AT +++ EA K+ Sbjct 447 TKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHATHDQVVEACKM 506 Query 79 ANAAGFIESFPDGYRTNVGAGGAQLSGGQKQRIAIARALIRKPRLLILDEATS 131 ANA FI+ PDGY T VG G QLSGGQKQRIAIARAL++ P++L+LDEATS Sbjct 507 ANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATS 559 Lambda K H 0.311 0.130 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40