bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3390_orf2 Length=87 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE1020w 110 2e-23 > 5833.PFE1020w Length=103 Score = 110 bits (274), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 48/72 (66%), Positives = 61/72 (84%), Gaps = 0/72 (0%) Query 15 MFYVTFLQKLAQKNSEVIVELKNDLQICGILHSVDLYLNIKLTQVNINDPDKCPHLLSVR 74 M + TF Q+LA+KN V VELKNDLQI G+LHSVD YLNIKLT V++N+P+K PHLLS++ Sbjct 1 MLFFTFFQQLAEKNHHVTVELKNDLQISGVLHSVDQYLNIKLTNVSVNNPEKYPHLLSIK 60 Query 75 NCFIRGSAVRYI 86 +CF+RGS VRY+ Sbjct 61 SCFVRGSVVRYV 72 Lambda K H 0.327 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22371284777 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40