bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0024_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value SPAC1071.09c 43.5 1e-04 Hs8922563 42.7 2e-04 Hs22046868 42.0 3e-04 SPBC3E7.11c 41.6 3e-04 Hs8923030 41.2 5e-04 7298311 40.8 6e-04 7299426 40.4 7e-04 At4g10130 39.3 0.002 ECU10g1100 39.3 0.002 At3g08970 39.3 0.002 At5g03160 39.3 0.002 At1g56300 38.9 0.002 Hs21361589 38.5 0.003 Hs4507713 38.5 0.003 At1g68370 38.5 0.003 Hs5921581 37.7 0.005 CE04708 37.4 0.006 Hs17388799 37.4 0.006 At1g24120 37.0 0.008 SPAC4H3.01 37.0 0.009 YNL227c 37.0 0.009 At1g74250 37.0 0.010 Hs7706495 36.6 0.011 CE03412 36.6 0.011 Hs6631085 36.6 0.011 Hs21361912 36.6 0.011 At2g41000 36.6 0.012 YLR090w 36.2 0.014 7296710 36.2 0.014 SPBC543.02c 36.2 0.014 7299832 36.2 0.017 CE16015 35.8 0.017 Hs4885495 35.8 0.018 YER048c 35.8 0.018 Hs7657611 35.8 0.018 7295437 35.8 0.018 Hs20558671 35.8 0.018 CE03728 35.8 0.020 7296521 35.8 0.021 7296520 35.4 0.028 CE16336 35.4 0.029 7293091 35.4 0.029 At1g59980 35.0 0.031 SPBC1347.05c 35.0 0.036 At5g53150 35.0 0.036 At3g47940 35.0 0.036 CE20265_1 34.7 0.041 YIR004w 34.7 0.044 At2g20560 34.7 0.047 CE01664 34.7 0.049 > SPAC1071.09c Length=282 Score = 43.5 bits (101), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 0/44 (0%) Query 31 PYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATE 74 PY+VLGV +DAS I++A+R+K L HPD+ H + + E Sbjct 32 PYSVLGVEKDASDELIRRAYRKKALQHHPDRIHDEEKKVEARIE 75 > Hs8922563 Length=304 Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y +LG+ A+ +KKA+RQK L CHPDK Sbjct 13 YALLGIEEKAADKEVKKAYRQKALSCHPDK 42 > Hs22046868 Length=317 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 0/40 (0%) Query 22 VPSSRRHRCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 V ++ R Y +LGVSRDAS +KKA+R+ L HPDK Sbjct 33 VQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDK 72 > SPBC3E7.11c Length=355 Score = 41.6 bits (96), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Query 29 RCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEKPSTPAQ 81 R Y +L +S DA TIKK++R+ +L HPDK ++P +A EK A+ Sbjct 8 RDYYDILNISVDADGDTIKKSYRRLAILYHPDKNR---ENPEAAREKFQKLAE 57 > Hs8923030 Length=375 Score = 41.2 bits (95), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 18/32 (56%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQH 63 Y +LGVSR AS +KKA+R+ L HPDK H Sbjct 112 YEILGVSRGASDEDLKKAYRRLALKFHPDKNH 143 > 7298311 Length=508 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 29/44 (65%), Gaps = 5/44 (11%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEK 75 Y +LG+ R+AS IKKA+R+K L+ HPD+ + SSA E+ Sbjct 404 YKILGIGRNASDDEIKKAYRKKALVHHPDR-----HANSSAEER 442 > 7299426 Length=275 Score = 40.4 bits (93), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y +LG+S ++ I+KA+R+K L CHPDK Sbjct 12 YDLLGISLESDQNEIRKAYRKKALECHPDK 41 > At4g10130 Length=174 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 0/43 (0%) Query 28 HRCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPS 70 H Y +L V DAS+ I+ ++R +L HPDK + T++S S Sbjct 9 HETYYEILSVKEDASYEEIRNSYRSAILHSHPDKLNNTSRSSS 51 > ECU10g1100 Length=228 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEKPSTPAQGTSTEP 87 Y +LGVSR+AS T IK AF ++ HPD +T SSA A T P Sbjct 80 YGILGVSRNASQTEIKNAFNALIMKFHPD---RTGMHESSAVSGMIQNAYATLGNP 132 > At3g08970 Length=572 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Query 31 PYTVLGVSRDASFTTIKKAFRQKVLLCHPDK-QHKTAQ 67 PY VLGVS+DA I+KAF ++ L HPDK + K AQ Sbjct 28 PYKVLGVSKDAKQREIQKAFHKQSLKYHPDKNKDKGAQ 65 > At5g03160 Length=482 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y +LG+SR AS + IKKA+++ L HPDK Sbjct 372 YKILGISRTASISEIKKAYKKLALQWHPDK 401 > At1g56300 Length=97 Score = 38.9 bits (89), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATE 74 YT+LG+ +DAS + I+ A+R+ + HPD + A++P A E Sbjct 15 YTILGIRKDASVSDIRTAYRKLAMKWHPD---RYARNPGVAGE 54 > Hs21361589 Length=412 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 31 PYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQH 63 P+ VLGV AS +KKA+RQ ++ HPDK H Sbjct 154 PFHVLGVEATASDVELKKAYRQLAVMVHPDKNH 186 > Hs4507713 Length=484 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query 1 HQKKYSSETQLEPLRMPDDPVVPSSRRHRCPY-TVLGVSRDASFTTIKKAFRQKVLLCHP 59 ++K Y +E E ++ + + + R Y +LGV ++AS IKKA+R++ L+ HP Sbjct 341 YEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHP 400 Query 60 DKQ 62 D+ Sbjct 401 DRH 403 > At1g68370 Length=410 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Query 23 PSSRRHRCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 P++RR PY VL VS+DA+ IK A+R+ L HPDK Sbjct 12 PANRRD--PYEVLCVSKDANDQEIKSAYRKLALKYHPDKN 49 > Hs5921581 Length=351 Score = 37.7 bits (86), Expect = 0.005, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y +L V R AS IKKA+R+K L HPDK Sbjct 5 YEILDVPRSASADDIKKAYRRKALQWHPDKN 35 > CE04708 Length=215 Score = 37.4 bits (85), Expect = 0.006, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y VLG+ ++A+ IKKA+R+ L HPDK Sbjct 40 YNVLGIQKNATDDEIKKAYRKLALRYHPDKN 70 > Hs17388799 Length=326 Score = 37.4 bits (85), Expect = 0.006, Method: Compositional matrix adjust. Identities = 18/31 (58%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y VLGV R AS IKKA+R+ L HPDK Sbjct 5 YEVLGVQRHASPEDIKKAYRKLALKWHPDKN 35 > At1g24120 Length=447 Score = 37.0 bits (84), Expect = 0.008, Method: Compositional matrix adjust. Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Query 29 RCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSA 72 R PY VLGV R+++ IK A+R+ L HPD KTA P +A Sbjct 19 RDPYEVLGVLRNSTDQEIKSAYRKLALKYHPD---KTANDPVAA 59 > SPAC4H3.01 Length=392 Score = 37.0 bits (84), Expect = 0.009, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 0/50 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEKPSTPAQ 81 Y +LG+S DA+ IKKA+R+ + HPDK Q S +K S Q Sbjct 10 YDLLGISTDATAVDIKKAYRKLAVKYHPDKNPDDPQGASEKFQKISEAYQ 59 > YNL227c Length=590 Score = 37.0 bits (84), Expect = 0.009, Method: Composition-based stats. Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query 30 CPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEK 75 C Y +LGV AS +KKA+R+K L HPDK + AT+K Sbjct 4 CYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVE---EATQK 46 > At1g74250 Length=630 Score = 37.0 bits (84), Expect = 0.010, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 0/43 (0%) Query 24 SSRRHRCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTA 66 S RC Y VLG+S+++S I+ ++R+ L HPDK K A Sbjct 5 SRSEKRCHYEVLGISKESSPDEIRSSYRRLALQRHPDKLMKAA 47 > Hs7706495 Length=358 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 29 RCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 R Y +LGV R AS IKKA+R+ L HPD+ Sbjct 24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDR 56 > CE03412 Length=331 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y VLG+S+ A+ IKKA+R+ L HPDK Sbjct 6 YKVLGISKGATDDEIKKAYRKMALKYHPDKN 36 > Hs6631085 Length=337 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y +LG+ + AS IKKA+R++ L HPDK Sbjct 6 YCILGIEKGASDEDIKKAYRKQALKFHPDKN 36 > Hs21361912 Length=554 Score = 36.6 bits (83), Expect = 0.011, Method: Compositional matrix adjust. Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y LGV +DAS I+KA+R+ L HPDK Sbjct 67 YQFLGVQQDASSADIRKAYRKLSLTLHPDK 96 > At2g41000 Length=286 Score = 36.6 bits (83), Expect = 0.012, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 3/38 (7%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSP 69 Y VLGV+R+A+ +K AFR+ + HPDK AQSP Sbjct 96 YQVLGVTRNATKKEVKDAFRRLAIKYHPDKH---AQSP 130 > YLR090w Length=459 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y VLGV+RDA+ IK A+R+ L HPDK Sbjct 11 YDVLGVTRDATVQEIKTAYRKLALKHHPDK 40 > 7296710 Length=183 Score = 36.2 bits (82), Expect = 0.014, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y +L V ASF IK +++Q +L CHPDK Sbjct 5 YELLNVPSTASFDEIKCSYKQLILQCHPDK 34 > SPBC543.02c Length=476 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 23/30 (76%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y +LGVS++A+ IKKA+R+ L+ HPDK Sbjct 351 YKILGVSKEATDIEIKKAYRKLALVYHPDK 380 > 7299832 Length=370 Score = 36.2 bits (82), Expect = 0.017, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y VLGVS+ A+ + IKKA+++ L HPDK Sbjct 108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKN 138 > CE16015 Length=402 Score = 35.8 bits (81), Expect = 0.017, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQ 67 Y VLGV DAS +KKA+R+ L HPDK A+ Sbjct 8 YDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAE 43 > Hs4885495 Length=241 Score = 35.8 bits (81), Expect = 0.018, Method: Compositional matrix adjust. Identities = 18/31 (58%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y VLGV R AS IKKA+R+ L HPDK Sbjct 5 YEVLGVQRHASPEDIKKAYRKLALKWHPDKN 35 > YER048c Length=391 Score = 35.8 bits (81), Expect = 0.018, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y +LG+ +A+ T IKKA+R+K + HPDK Sbjct 8 YDILGIKPEATPTEIKKAYRRKAMETHPDKH 38 > Hs7657611 Length=264 Score = 35.8 bits (81), Expect = 0.018, Method: Compositional matrix adjust. Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 5/69 (7%) Query 6 SSETQLEPLRMPDDPVVPSSRRHRCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKT 65 +S+ Q+E L P SS + P+ VL + + + IKK FRQ +L HPDK Sbjct 49 TSKNQIERLTRP-----GSSYFNLNPFEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDD 103 Query 66 AQSPSSATE 74 A A E Sbjct 104 ADRAQKAFE 112 > 7295437 Length=334 Score = 35.8 bits (81), Expect = 0.018, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y +LG+ R AS IKKA+R+ L HPDK Sbjct 6 YKILGLERKASDDEIKKAYRKLALKYHPDKN 36 > Hs20558671 Length=241 Score = 35.8 bits (81), Expect = 0.018, Method: Compositional matrix adjust. Identities = 18/31 (58%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y VLGV R AS IKKA+R+ L HPDK Sbjct 5 YEVLGVQRHASPEDIKKAYRKLALKWHPDKN 35 > CE03728 Length=242 Score = 35.8 bits (81), Expect = 0.020, Method: Compositional matrix adjust. Identities = 24/95 (25%), Positives = 36/95 (37%), Gaps = 7/95 (7%) Query 30 CPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEK---PSTPAQGTSTE 86 C Y +LGV +D +KK + ++ + HPDK + + + T K + Q S E Sbjct 14 CLYELLGVKKDCDEKALKKGYYRQSMRWHPDKSNLVEEDMQTYTTKFQLLNKAYQILSDE 73 Query 87 PATGVPRRGAQPPTSAGTPTGAPNETVSTASRTAL 121 R+ S G NE A R Sbjct 74 E----KRKIYDETGSVDDEAGELNEDALKAWRMIF 104 > 7296521 Length=128 Score = 35.8 bits (81), Expect = 0.021, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y +LG+ R+AS +KK +R+ L HPDK Sbjct 6 YKILGIERNASSEDVKKGYRRMALRYHPDKN 36 > 7296520 Length=162 Score = 35.4 bits (80), Expect = 0.028, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 0/43 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATE 74 Y VLG+ R+A+ + IK AFR+ L HPDK A+ E Sbjct 9 YQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRINE 51 > CE16336 Length=510 Score = 35.4 bits (80), Expect = 0.029, Method: Composition-based stats. Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 0/44 (0%) Query 18 DDPVVPSSRRHRCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 D V+ S +C Y VL V RDA IKK +R+ L HPDK Sbjct 16 DFNVILVSTTMKCHYEVLEVERDADDDKIKKNYRKLALKWHPDK 59 > 7293091 Length=333 Score = 35.4 bits (80), Expect = 0.029, Method: Compositional matrix adjust. Identities = 18/41 (43%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSA 72 Y VLGV+R++S + I KA+RQ HPD H+ A++ ++A Sbjct 33 YDVLGVTRESSKSEIGKAYRQLARRYHPD-LHRGAEAKAAA 72 > At1g59980 Length=384 Score = 35.0 bits (79), Expect = 0.031, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 27 RHRCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 R R PY VLG+ +++ IK A+R+ L HPDK Sbjct 20 RRRNPYEVLGIPSNSTDQEIKSAYRRMALRYHPDKN 55 > SPBC1347.05c Length=386 Score = 35.0 bits (79), Expect = 0.036, Method: Composition-based stats. Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%) Query 34 VLGVSRDASFTTIKKAFRQKVLLCHPDK 61 +LGVS+DAS + I+KA+RQ HPDK Sbjct 11 ILGVSKDASESEIRKAYRQLTKQWHPDK 38 > At5g53150 Length=755 Score = 35.0 bits (79), Expect = 0.036, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y VLGV AS +KK +R+ VL+ HPDK Sbjct 68 YGVLGVDPFASDEALKKQYRKLVLMLHPDKN 98 > At3g47940 Length=350 Score = 35.0 bits (79), Expect = 0.036, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 0/56 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEKPSTPAQGTSTEP 87 Y +L V+ +A+ +KKA+++ ++ HPDK T + + A K + A ++P Sbjct 6 YNILKVNHNATEDDLKKAYKRLAMIWHPDKNPSTRRDEAEAKFKRISEAYDVLSDP 61 > CE20265_1 Length=114 Score = 34.7 bits (78), Expect = 0.041, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 0/31 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDKQ 62 Y +LGV RDA TI+KAF++ + HPD+ Sbjct 22 YELLGVERDADDRTIRKAFKKLAIKKHPDRN 52 > YIR004w Length=432 Score = 34.7 bits (78), Expect = 0.044, Method: Composition-based stats. Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 0/30 (0%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK 61 Y +LGVS AS IKKA+R+K + HPDK Sbjct 8 YDLLGVSTTASSIEIKKAYRKKSIQEHPDK 37 > At2g20560 Length=337 Score = 34.7 bits (78), Expect = 0.047, Method: Compositional matrix adjust. Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 7/82 (8%) Query 32 YTVLGVSRDASFTTIKKAFRQKVLLCHPDK---QHKTAQS----PSSATEKPSTPAQGTS 84 Y VL V R AS +KKA+R+ + HPDK K A++ S A E S P + Sbjct 6 YKVLQVDRSASDDDLKKAYRKLAMKWHPDKNPNNKKDAEAMFKQISEAYEVLSDPQKKAV 65 Query 85 TEPATGVPRRGAQPPTSAGTPT 106 + +G PP AG T Sbjct 66 YDQYGEEGLKGNVPPPDAGGAT 87 > CE01664 Length=355 Score = 34.7 bits (78), Expect = 0.049, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Query 29 RCPYTVLGVSRDASFTTIKKAFRQKVLLCHPDKQHKTAQSPSSATEK 75 R Y +LGV+++A+ IKKA+R+ HPD+ Q A EK Sbjct 23 RDFYKILGVAKNANANQIKKAYRKLAKELHPDRN----QDDEMANEK 65 Lambda K H 0.308 0.122 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1183965632 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40