bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0049_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value Hs14785495 42.7 1e-04 At3g58560 42.4 2e-04 At3g58580 41.6 4e-04 CE24708 40.0 0.001 CE24709 40.0 0.001 SPCC31H12.08c 40.0 0.001 At5g11350 38.1 0.004 YAL021c 35.4 0.027 At1g31500 35.0 0.030 ECU11g0770 34.7 0.040 7301122 34.3 0.052 Hs20476839 34.3 0.064 At3g18500 32.3 0.23 7290461 30.4 0.88 At2g48100_2 28.9 2.3 At1g31530 28.9 2.4 At2g37460 28.5 2.8 CE16315 28.5 3.2 Hs20555377 28.1 4.0 At1g16460 28.1 4.7 Hs4504843 27.3 6.8 > Hs14785495 Length=362 Score = 42.7 bits (99), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 18/73 (24%) Query 18 KMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLEL 77 ++ H QL SAY EN+ L P +TNYT +F G +DYIF+S ++ + Sbjct 235 RITHGFQLKSAY----------ENN-------LMP-YTNYTFDFKGVIDYIFYSKTHMNV 276 Query 78 VGILEPIFEQQLI 90 +G+L P+ Q L+ Sbjct 277 LGVLGPLDPQWLV 289 > At3g58560 Length=597 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 5/70 (7%) Query 12 VLPLHWKMQHSLQLASAYA----LGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDY 67 +L H K+ H L L SAY+ +G ++ ++ ++ EP+FTN T +F+G LDY Sbjct 483 ILRPHSKLTHQLPLVSAYSQFAKMGGNVITEQQRRRLDPASS-EPLFTNCTRDFIGTLDY 541 Query 68 IFFSPFNLEL 77 IF++ L + Sbjct 542 IFYTADTLTV 551 > At3g58580 Length=605 Score = 41.6 bits (96), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 12/72 (16%) Query 12 VLPLHWKMQHSLQLASAYA--LGRALLDVEENDGVEVYRQL------EPIFTNYTPNFVG 63 +L H K+ H L L SAY+ + + ++ + G+E +R+ EP+FTN T +F+G Sbjct 493 ILRPHTKLTHQLPLVSAYSSFVRKGIMGL----GLEQHRRRIDLNTNEPLFTNCTRDFIG 548 Query 64 CLDYIFFSPFNL 75 DYIF++ L Sbjct 549 THDYIFYTADTL 560 > CE24708 Length=787 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Query 54 FTNYTPNFVGCLDYIFFSPFNLELVGILEPIFEQQLIR 91 FTNYT +F G +DYIF +P +L +GIL P F+ Q ++ Sbjct 688 FTNYTLDFKGMIDYIFATPQSLARLGILGP-FDPQWVQ 724 > CE24709 Length=794 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Query 54 FTNYTPNFVGCLDYIFFSPFNLELVGILEPIFEQQLIR 91 FTNYT +F G +DYIF +P +L +GIL P F+ Q ++ Sbjct 695 FTNYTLDFKGMIDYIFATPQSLARLGILGP-FDPQWVQ 731 > SPCC31H12.08c Length=690 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 17/69 (24%) Query 21 HSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLELVGI 80 H+ L SAY AL FTNYTP F G +D+I+++ +LE+ G+ Sbjct 598 HAFNLKSAYGESEAL-----------------SFTNYTPGFKGAIDHIWYTGNSLEVTGL 640 Query 81 LEPIFEQQL 89 L+ + + L Sbjct 641 LKGVDKDYL 649 > At5g11350 Length=700 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 8/76 (10%) Query 14 PLHWKMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPF 73 P ++H+L+L S Y+ + + +G EP+ T+Y F+G +DYI+ S Sbjct 600 PERTTVEHALELKSTYSEVEGQANTRDENG-------EPVVTSYHRCFMGTVDYIWRSE- 651 Query 74 NLELVGILEPIFEQQL 89 L+ V +L PI +Q + Sbjct 652 GLQTVRVLAPIPKQAM 667 > YAL021c Length=837 Score = 35.4 bits (80), Expect = 0.027, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 54 FTNYTPNFVGCLDYIFFSPFNLELVGIL 81 FTN+TP+F +DYI+FS L + G+L Sbjct 768 FTNFTPSFTDVIDYIWFSTHALRVRGLL 795 > At1g31500 Length=335 Score = 35.0 bits (79), Expect = 0.030, Method: Compositional matrix adjust. Identities = 21/39 (53%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Query 45 EVYRQLEPIFTNYTPNFVGCLDYIFFSPFN-LELVGILE 82 EV R EP FTN TP F LDYIF SP + ++ V IL+ Sbjct 264 EVTRG-EPKFTNCTPGFTNTLDYIFISPSDFIKPVSILQ 301 > ECU11g0770 Length=493 Score = 34.7 bits (78), Expect = 0.040, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query 54 FTNYTPNFVGCLDYIFFSPFNLELVGILEPIFEQ 87 FTN+TP F G +DYIF+ + L +L P+ ++ Sbjct 419 FTNFTPGFKGVIDYIFYGG-GISLASVLSPVEDE 451 > 7301122 Length=278 Score = 34.3 bits (77), Expect = 0.052, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 18/64 (28%) Query 21 HSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLELVGI 80 HS +LASAY N+ + + TNYT +F G +DYIF++ + +G+ Sbjct 185 HSFKLASAY-----------NEDIMPH-------TNYTFDFKGIIDYIFYTKTGMVPLGL 226 Query 81 LEPI 84 L P+ Sbjct 227 LGPV 230 > Hs20476839 Length=139 Score = 34.3 bits (77), Expect = 0.064, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 51 EPIFTNYTPNFVGCLDYIFFSPFNLELVGIL 81 EP +TNY F GCLDYIF LE+ ++ Sbjct 76 EPAYTNYVGGFHGCLDYIFIDLNALEVEQVI 106 > At3g18500 Length=451 Score = 32.3 bits (72), Expect = 0.23, Method: Compositional matrix adjust. Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Query 21 HSLQLASAYALGRALLDVEENDGVEVYRQLEPIFTNYTPNFVGCLDYIFFS 71 H L+L S+YA + + ++ G EP+ T+Y F+G +DY+++S Sbjct 363 HPLKLNSSYASVKGSANTRDSVG-------EPLATSYHSKFLGTVDYLWYS 406 > 7290461 Length=788 Score = 30.4 bits (67), Expect = 0.88, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 0/44 (0%) Query 64 CLDYIFFSPFNLELVGILEPIFEQQLIREGSSSSSATAKTYCLC 107 C + F+PF++ LV ++ F+Q I + +SS A ++ Y +C Sbjct 337 CKVFDLFTPFSVGLVYLMYKCFQQIAIIKPNSSRPANSERYLVC 380 > At2g48100_2 Length=1208 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 0/21 (0%) Query 8 QHKEVLPLHWKMQHSLQLASA 28 Q K V PLHW +Q L LASA Sbjct 3 QEKNVDPLHWALQLRLTLASA 23 > At1g31530 Length=283 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 47 YRQLEPIFTNYTPNFVGCLDYIFFS 71 + + EP FTN P F LDY+F++ Sbjct 217 FTKGEPRFTNNVPGFAETLDYMFYT 241 > At2g37460 Length=380 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 73 FNLELVGILEPIFEQQLIREGSSSSSATAKT 103 F + L+G+LEP+ +Q L G ++AT T Sbjct 79 FKISLLGLLEPVIDQNLYYLGMKYTTATFAT 109 > CE16315 Length=628 Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust. Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 5/23 (21%) Query 52 PIFTNYTPN-----FVGCLDYIF 69 P +TNYT + FVGCLDYI+ Sbjct 564 PEYTNYTASSQKDGFVGCLDYIW 586 > Hs20555377 Length=835 Score = 28.1 bits (61), Expect = 4.0, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 0/44 (0%) Query 64 CLDYIFFSPFNLELVGILEPIFEQQLIREGSSSSSATAKTYCLC 107 C + F+PF++ LV +L FE+ + + +S A ++ Y +C Sbjct 403 CKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVC 446 > At1g16460 Length=318 Score = 28.1 bits (61), Expect = 4.7, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 19 MQHSLQLASAYALGRALLDVEENDGVEVYRQL 50 ++H L A+A G + L +E NDGV VY + Sbjct 79 LRHMLPSEEAFAAGCSALGIENNDGVVVYDGM 110 > Hs4504843 Length=423 Score = 27.3 bits (59), Expect = 6.8, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 0/55 (0%) Query 1 HQSVNPQQHKEVLPLHWKMQHSLQLASAYALGRALLDVEENDGVEVYRQLEPIFT 55 HQ P+Q ++ LP H + + Y +V + E YR L IFT Sbjct 28 HQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDIFT 82 Lambda K H 0.321 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194805952 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40