bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0116_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value At1g77470 45.1 3e-05 7297692 37.4 0.007 CE29044 37.0 0.010 YNL290w 34.3 0.063 Hs7661832 29.6 1.4 Hs21536371_1 29.3 2.0 7297150 29.3 2.1 HsM6005894_1 29.3 2.1 At3g09040 27.3 7.7 > At1g77470 Length=369 Score = 45.1 bits (105), Expect = 3e-05, Method: Composition-based stats. Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 0/75 (0%) Query 2 PSEVKSIMQVLLEKDLRTCSLEFHGLVTRRGYSVRDWVGALHCQMQNMKLPVPVALTLVT 61 P +++ I LL K C + + TR+G ++ D V + + +K+P V + L+ Sbjct 272 PKDIEQISHWLLNKPFDECYKDVSEIKTRKGLAIVDIVKEITLFIFKIKMPSAVRVQLIN 331 Query 62 RLADIEERLALGSGD 76 LADIE RL+ G D Sbjct 332 DLADIEYRLSFGCND 346 > 7297692 Length=297 Score = 37.4 bits (85), Expect = 0.007, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 0/43 (0%) Query 31 RGYSVRDWVGALHCQMQNMKLPVPVALTLVTRLADIEERLALG 73 RG ++ D + LH + ++LP+ V L+ +LA IEERLA G Sbjct 230 RGLALEDIITELHLFVMRLELPMSVMNKLIVKLAQIEERLAKG 272 > CE29044 Length=388 Score = 37.0 bits (84), Expect = 0.010, Method: Composition-based stats. Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 0/75 (0%) Query 2 PSEVKSIMQVLLEKDLRTCSLEFHGLVTRRGYSVRDWVGALHCQMQNMKLPVPVALTLVT 61 P E+K +++ LL + C + GY+++D + LH + + +P ++T Sbjct 282 PKEMKEVVKTLLNDPSKKCMNTIQTKLFENGYALQDVITHLHDFVFTLDIPDEAMSAIIT 341 Query 62 RLADIEERLALGSGD 76 L ++EE L+ G + Sbjct 342 GLGEVEENLSTGCSN 356 > YNL290w Length=340 Score = 34.3 bits (77), Expect = 0.063, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 45/79 (56%), Gaps = 1/79 (1%) Query 1 QPSEVKSIMQVLLEKDLRTCSLEFHGLVTRRGYSVRDWVGALHCQMQNMKLP-VPVALTL 59 +PS++K++++ +LE D T + + + +G ++ D + + +++ +L + L Sbjct 240 RPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHL 299 Query 60 VTRLADIEERLALGSGDYV 78 +T+LADIE ++ G D + Sbjct 300 LTKLADIEYSISKGGNDQI 318 > Hs7661832 Length=194 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Query 21 SLEFHGLVTRRGYSVRDWVGALHCQMQNMKLPVPV 55 S+E H ++++RG+SVR + H +KLP P Sbjct 19 SMEAHNILSKRGFSVRSFGTGTH-----VKLPGPA 48 > Hs21536371_1 Length=1436 Score = 29.3 bits (64), Expect = 2.0, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 0/39 (0%) Query 31 RGYSVRDWVGALHCQMQNMKLPVPVALTLVTRLADIEER 69 R + D + AL Q++N LP P +TL+ R+ E+ Sbjct 565 RFLNAHDAIDALEAQLRNQALPFPSNITLMRRILTRNEK 603 > 7297150 Length=425 Score = 29.3 bits (64), Expect = 2.1, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 9/68 (13%) Query 6 KSIMQVLLEKD--LRTCSLEFHGLVTRRGYSVRD------WVGALHCQMQNMKLPVPVAL 57 ++ QVLLE D LR + GL+ R G + + W+ LH + N+ VP+ Sbjct 65 QTTAQVLLETDALLRQRFVYGRGLL-RMGRIIEELDLLAVWICHLHIHLPNLPEGVPLPY 123 Query 58 TLVTRLAD 65 T +T L D Sbjct 124 TFITMLVD 131 > HsM6005894_1 Length=1436 Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 0/39 (0%) Query 31 RGYSVRDWVGALHCQMQNMKLPVPVALTLVTRLADIEER 69 R + D + AL Q++N LP P +TL+ R+ E+ Sbjct 565 RFLNAHDAIDALEAQLRNQALPFPSNITLMRRILTRNEK 603 > At3g09040 Length=1028 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Query 2 PSEVK--SIMQVLLEKDLRTCSLEFHGLVTRRGYS 34 PSE+ +I++ + + T +FHG +T+RG+S Sbjct 627 PSEITFATIVEACHKPESLTLGTQFHGQITKRGFS 661 Lambda K H 0.323 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40