bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0339_orf1 Length=52 Score E Sequences producing significant alignments: (Bits) Value Hs7705913 44.3 6e-05 At3g61650 36.2 0.015 7298556 36.2 0.015 At5g05620 35.8 0.018 7295874 35.8 0.019 ECU03g0820i 34.7 0.038 Hs14785923 34.7 0.044 Hs4507731 34.7 0.044 Hs7706751 34.7 0.048 Hs17453109 32.7 0.14 Hs7705915 32.3 0.24 SPBC32F12.04 32.0 0.30 Hs14777268 31.6 0.34 CE00224 31.6 0.35 At5g44340 31.2 0.52 At5g62700 30.4 0.82 At5g62690 30.4 0.82 At2g29550 30.4 0.85 At4g20890 30.0 1.0 Hs5174735 30.0 1.2 Hs22048081 30.0 1.2 7302471 30.0 1.2 CE13183 29.6 1.5 At5g12250 29.3 1.8 At1g20010 29.3 1.9 At1g75780 29.3 1.9 Hs22059949 29.3 2.0 7301653 28.9 2.3 CE15257 28.9 2.4 HsM5174739 28.9 2.7 Hs21361322 28.9 2.7 YLR212c 28.5 2.8 Hs4507729 28.5 3.1 Hs9910594 28.5 3.1 ECU08g0670 28.5 3.2 CE00850 28.5 3.3 Hs22045416 28.1 4.1 7299175 27.7 4.8 Hs22068073_2 27.7 5.2 CE00913 27.7 5.2 Hs5174737 27.7 5.3 CE16197 27.7 5.5 Hs20540557 27.7 5.9 Hs13562114 27.7 5.9 At3g53170 27.3 6.5 CE05494 27.3 6.8 Hs22045978 26.9 9.6 > Hs7705913 Length=453 Score = 44.3 bits (103), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 0/47 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGG 47 G GNNWA G+ GP + ES+ +++ E+ DS S ++ S+AGG Sbjct 99 GSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFSGFFIIMSMAGG 145 > At3g61650 Length=474 Score = 36.2 bits (82), Expect = 0.015, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGG 47 G GNNWA G+ QG E + ++ A+ DS+ ++ HS+AGG Sbjct 99 GAGNNWASGYH-QGKGVEEEIMDMIDREADGSDSLEGFVLCHSIAGG 144 > 7298556 Length=457 Score = 36.2 bits (82), Expect = 0.015, Method: Composition-based stats. Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGG 47 G GNNWA G QG +E + +L A+ DS+ ++ HS+AGG Sbjct 99 GAGNNWASGFS-QGEKVQEEVFDILDREADGSDSLEGFVLCHSIAGG 144 > At5g05620 Length=474 Score = 35.8 bits (81), Expect = 0.018, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGG 47 G GNNWA G+ QG E + ++ A+ DS+ ++ HS+AGG Sbjct 99 GAGNNWASGYH-QGKGVEEEIMDMIDREADGSDSLEGFVLCHSIAGG 144 > 7295874 Length=475 Score = 35.8 bits (81), Expect = 0.019, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGG 47 G GNNWA G+ QG +E + ++ A+ DS+ ++ HS+AGG Sbjct 99 GAGNNWASGYS-QGEKLQEEVFDIIDREADGSDSLEGFILCHSIAGG 144 > ECU03g0820i Length=439 Score = 34.7 bits (78), Expect = 0.038, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 0/44 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSL 44 G GNNWA GH +G +S+ ++ AE D + + HSL Sbjct 96 GAGNNWAKGHYTEGAELIDSVMDVVRKEAESSDCLQGFQITHSL 139 > Hs14785923 Length=451 Score = 34.7 bits (78), Expect = 0.044, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGGRQKSL 52 G GNNWA G QG E + ++ A+ DS+ ++ HS+AGG L Sbjct 99 GAGNNWASGFS-QGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGL 149 > Hs4507731 Length=451 Score = 34.7 bits (78), Expect = 0.044, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGGRQKSL 52 G GNNWA G QG E + ++ A+ DS+ ++ HS+AGG L Sbjct 99 GAGNNWASGFS-QGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGL 149 > Hs7706751 Length=451 Score = 34.7 bits (78), Expect = 0.048, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGGRQKSL 52 G GNNWA G QG E + ++ A+ DS+ ++ HS+AGG L Sbjct 99 GAGNNWASGFS-QGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGL 149 > Hs17453109 Length=352 Score = 32.7 bits (73), Expect = 0.14, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 0/47 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGG 47 G GNNWA GH +G +S+ ++ AE D + + HSL G Sbjct 244 GAGNNWANGHYAEGAELVDSVLDIVRREAESCDCLQDFQLTHSLGAG 290 > Hs7705915 Length=475 Score = 32.3 bits (72), Expect = 0.24, Method: Compositional matrix adjust. Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 0/44 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSL 44 G GNNWA+GH+ G ++ + AE D + ++HS+ Sbjct 104 GSGNNWAVGHKVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSM 147 > SPBC32F12.04 Length=446 Score = 32.0 bits (71), Expect = 0.30, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGGRQKSL 52 G GNNWA G+ E + ++ A+ DS+ +LHS+AGG L Sbjct 99 GAGNNWANGYS-HAERIFEDIMDMIDREADGSDSLEGFSLLHSIAGGTGSGL 149 > Hs14777268 Length=396 Score = 31.6 bits (70), Expect = 0.34, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G ES+ ++ AE D + + H Sbjct 96 GAGNNWAEGHYTEGAELTESVMDVVRKEAESCDCLQGFQLTH 137 > CE00224 Length=444 Score = 31.6 bits (70), Expect = 0.35, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSL 44 G GNNWA G+ QG +E + +++ AE +++ I+ HS+ Sbjct 101 GAGNNWASGY-CQGQEVQEKIMDIIIREAENTNNLDGILFTHSV 143 > At5g44340 Length=444 Score = 31.2 bits (69), Expect = 0.52, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + V H Sbjct 96 GAGNNWAKGHYTEGAELIDSVLDVVRKEAENSDCLQGFQVCH 137 > At5g62700 Length=450 Score = 30.4 bits (67), Expect = 0.82, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + V H Sbjct 96 GAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCH 137 > At5g62690 Length=450 Score = 30.4 bits (67), Expect = 0.82, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + V H Sbjct 96 GAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCH 137 > At2g29550 Length=449 Score = 30.4 bits (67), Expect = 0.85, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + V H Sbjct 96 GAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCH 137 > At4g20890 Length=444 Score = 30.0 bits (66), Expect = 1.0, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + V H Sbjct 96 GAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCH 137 > Hs5174735 Length=445 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 137 > Hs22048081 Length=444 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 137 > 7302471 Length=456 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + + H Sbjct 105 GAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 146 > CE13183 Length=420 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNW+ G+ QG + + ++ AE DS+ ++H Sbjct 96 GAGNNWSRGYYEQGAEIVDKVLSVIRREAEAADSLEGFQLIH 137 > At5g12250 Length=449 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + V H Sbjct 96 GAGNNWAKGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCH 137 > At1g20010 Length=447 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + V H Sbjct 97 GAGNNWAKGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCH 138 > At1g75780 Length=447 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + V H Sbjct 97 GAGNNWAKGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCH 138 > Hs22059949 Length=208 Score = 29.3 bits (64), Expect = 2.0, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTH 137 > 7301653 Length=442 Score = 28.9 bits (63), Expect = 2.3, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ +L +E D + + H Sbjct 81 GAGNNWAKGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAH 122 > CE15257 Length=441 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDNVLDVVRKEAESTDCLQGFQLTH 137 > HsM5174739 Length=444 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTH 137 > Hs21361322 Length=444 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTH 137 > YLR212c Length=473 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query 3 GNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGGRQKSL 52 GN+WA G++ G N++ + + + + D+ +LHS+AGG L Sbjct 102 GNSWANGYDI-GTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGL 150 > Hs4507729 Length=445 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ +E D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTH 137 > Hs9910594 Length=434 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA G +G ES+ ++ AE D + + H Sbjct 96 GAGNNWAKGRYTEGAELMESVMDVVRKEAESCDCLQGFQLTH 137 > ECU08g0670 Length=434 Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSLAGG 47 G GNNW G+ G + + ++ AE D++ + ++LHS+AGG Sbjct 92 GAGNNWGHGYCV-GKAMGNDVIDMIQREAEGCDALETFLLLHSIAGG 137 > CE00850 Length=444 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDNVLDVVRKEAESCDCLQGFQMTH 137 > Hs22045416 Length=331 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 0/21 (0%) Query 1 GCGNNWALGHEFQGPSNRESM 21 G GNNWA GH +G +E++ Sbjct 96 GAGNNWAKGHYTEGAELKETL 116 > 7299175 Length=446 Score = 27.7 bits (60), Expect = 4.8, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ +E D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTH 137 > Hs22068073_2 Length=431 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ E D + + H Sbjct 77 GAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTH 118 > CE00913 Length=450 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTH 137 > Hs5174737 Length=450 Score = 27.7 bits (60), Expect = 5.3, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +S+ ++ E D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTH 137 > CE16197 Length=449 Score = 27.7 bits (60), Expect = 5.5, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTH 137 > Hs20540557 Length=300 Score = 27.7 bits (60), Expect = 5.9, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 0/44 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLHSL 44 G GNNWA H +G S+ L+ AE D + + HSL Sbjct 77 GAGNNWAKCHYTEGAELVYSVLDLVWKEAESCDCLQGFQLTHSL 120 > Hs13562114 Length=451 Score = 27.7 bits (60), Expect = 5.9, Method: Compositional matrix adjust. Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G E++ ++ +E D + ++H Sbjct 96 GAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVH 137 > At3g53170 Length=447 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 19 ESMEHLLLSLAEEGDSVSSIMVLHSLAG 46 E ME +L + E+GDS+ + L+S+ G Sbjct 217 EEMESVLADMIEDGDSLPDVCTLNSIIG 244 > CE05494 Length=452 Score = 27.3 bits (59), Expect = 6.8, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA GH +G +++ ++ AE D + + H Sbjct 96 GAGNNWAKGHYTEGAELVDNVLDVVRKEAEGCDCLQGFQLTH 137 > Hs22045978 Length=692 Score = 26.9 bits (58), Expect = 9.6, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 0/42 (0%) Query 1 GCGNNWALGHEFQGPSNRESMEHLLLSLAEEGDSVSSIMVLH 42 G GNNWA G+ +G ES+ + AE D + + H Sbjct 428 GAGNNWAKGYYTEGTELMESVMDTVRREAESCDCLQGFQLAH 469 Lambda K H 0.312 0.130 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1158678716 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40