bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0680_orf2 Length=131 Score E Sequences producing significant alignments: (Bits) Value YML004c 35.4 0.030 Hs18574443 34.7 0.042 Hs5729842 33.5 0.10 SPBC12C2.12c 33.5 0.12 Hs7705821 32.0 0.34 7304232 32.0 0.35 At1g08110 30.0 1.1 Hs22042827 29.3 2.3 At2g28420 28.5 3.2 Hs20481588 28.1 5.0 Hs22043220 27.7 5.7 > YML004c Length=326 Score = 35.4 bits (80), Expect = 0.030, Method: Compositional matrix adjust. Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 0/39 (0%) Query 2 TLKFYEDVLGMTLIDKKTAGSFGFTLYFLALESPTSTSL 40 +L+FY++VLGM L+ S FTLYFL P + S+ Sbjct 196 SLEFYQNVLGMKLLRTSEHESAKFTLYFLGYGVPKTDSV 234 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 2 TLKFYEDVLGMTLIDKKTAGSFGFTLYFLAL 32 T+KFY + GM L+ +K F+LYFL+ Sbjct 36 TVKFYTEHFGMKLLSRKDFEEAKFSLYFLSF 66 > Hs18574443 Length=391 Score = 34.7 bits (78), Expect = 0.042, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Query 81 FLCAESNEEKILKRIKRNYVKVELVDDEVYGQKVLLLRDPQNIPIRI 127 FLC E++ EK+LK+I R Y++ + +++++ + LLL DP +R+ Sbjct 340 FLCMETHYEKVLKKISR-YIQEQ--NEKIFAPRGLLLTDPVERGMRV 383 > Hs5729842 Length=184 Score = 33.5 bits (75), Expect = 0.10, Method: Compositional matrix adjust. Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 1 ETLKFYEDVLGMTLIDKKTAGSFGFTLYFLALE 33 ++L FY VLGMTLI K F+LYFLA E Sbjct 44 KSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYE 76 > SPBC12C2.12c Length=302 Score = 33.5 bits (75), Expect = 0.12, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%) Query 1 ETLKFYEDVLGMTLIDKKTAGSFGFTLYFLALESPTS 37 ++LKFY +V GM LID+ F+L FLA + P + Sbjct 24 KSLKFYTEVFGMKLIDQWVFEENEFSLSFLAFDGPGA 60 Score = 27.7 bits (60), Expect = 6.0, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query 2 TLKFYEDVLGMTLIDKKTAGSFGFTLYFLALES 34 ++ FYE LGM +IDK + FT YFLA S Sbjct 180 SIAFYEK-LGMKVIDKADHPNGKFTNYFLAYPS 211 > Hs7705821 Length=104 Score = 32.0 bits (71), Expect = 0.34, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Query 81 FLCAESNEEKILKRIKRNYVKVELVDDEVYGQKVLLLRDPQNIPIRI 127 FLC E++ EK+LK++ + Y++ + ++++Y + LLL DP +R+ Sbjct 46 FLCMETHYEKVLKKVSK-YIQEQ--NEKIYAPQGLLLTDPIERGLRV 89 > 7304232 Length=176 Score = 32.0 bits (71), Expect = 0.35, Method: Compositional matrix adjust. Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 1 ETLKFYEDVLGMTLIDKKTAGSFGFTLYFLALESPTS 37 ++L FY VLGMTL+ K F+LYFL E+ T Sbjct 40 KSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATD 76 > At1g08110 Length=185 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 0/32 (0%) Query 2 TLKFYEDVLGMTLIDKKTAGSFGFTLYFLALE 33 +L FY VLGM+L+ + F+LYFL E Sbjct 41 SLDFYSRVLGMSLLKRLDFSEMKFSLYFLGYE 72 > Hs22042827 Length=522 Score = 29.3 bits (64), Expect = 2.3, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 0/36 (0%) Query 28 YFLALESPTSTSLHYWLWLQRFSSICIKVHADGNHV 63 Y LA SP ++L YWLW ++ +++ N V Sbjct 121 YLLAQTSPPESNLVYWLWEKQKVMAIVRIDTQNNPV 156 > At2g28420 Length=184 Score = 28.5 bits (62), Expect = 3.2, Method: Compositional matrix adjust. Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 22/129 (17%) Query 1 ETLKFYEDVLGMTLIDKKTAGSFGFTLYFLALESPTSTSLHYWLWLQRFSSI-CIKVHAD 59 ++L+FY VLG I++ SF F +L +Y + + + K+ +D Sbjct 33 KSLEFYTKVLGFVEIER--PASFDFDGAWL---------FNYGVGIHLVQAKDQDKLPSD 81 Query 60 GNHVAPYKDLGPSECGFLGISFLCAESNE-EKILKRIKRNYVKVELVDDEVYGQKVLLLR 118 +H+ P + ISF C + EK LK +K Y+K + D++ L Sbjct 82 TDHLDPMDN---------HISFQCEDMEALEKRLKEVKVKYIKRTVGDEKDAAIDQLFFN 132 Query 119 DPQNIPIRI 127 DP + I Sbjct 133 DPDGFMVEI 141 > Hs20481588 Length=321 Score = 28.1 bits (61), Expect = 5.0, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 0/53 (0%) Query 75 GFLGISFLCAESNEEKILKRIKRNYVKVELVDDEVYGQKVLLLRDPQNIPIRI 127 G LG + S E K +RN + +L E +GQ+ +L R + +P R+ Sbjct 102 GILGREEILVNSVETKQCYSARRNDQEAQLGSLEKWGQRRILQRPDRRVPTRV 154 > Hs22043220 Length=667 Score = 27.7 bits (60), Expect = 5.7, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Query 80 SFL-CAESNEEKILKRIKRNYVKVELVDDEVYGQKVLLLRDPQNIPI 125 SFL C + N+++ K KR + L +D++ QKV L P IP+ Sbjct 261 SFLKCVKENDQE-KKEPKRKILGKTLTNDQIRSQKVFPLTPPCLIPV 306 Lambda K H 0.322 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1283105810 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40