bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0819_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value YPL109c 31.2 0.50 At1g61640 29.6 1.4 CE24201 28.5 3.5 At1g11390 27.3 6.8 YBR112c 26.9 9.5 Hs4507831 26.9 9.9 > YPL109c Length=543 Score = 31.2 bits (69), Expect = 0.50, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query 1 VEEFAVSMRRQLDFGLEEKHLKLFRSNFGLSTD-PIPSDILPLRNR 45 V++F++ M QLD +E +L+ F NF S P LPL NR Sbjct 247 VDQFSILMNIQLDLRIEALNLERFNENFKNSIQVKFPKPFLPLSNR 292 > At1g61640 Length=428 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query 1 VEEFAVSMRRQLDFGLEEKHLKLFRSNF-GLSTDPIPSDILPL 42 V++F+V M Q+D E HL F NF G P I PL Sbjct 161 VQQFSVYMLSQVDLSREASHLSRFIYNFRGWKDVSFPKPIYPL 203 > CE24201 Length=600 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 1 VEEFAVSMRRQLDFGLEEKHLKLFRSNF 28 +E+F + +RRQ+D E K LK F NF Sbjct 282 LEQFEMVLRRQVDLRNEAKALKKFSDNF 309 > At1g11390 Length=456 Score = 27.3 bits (59), Expect = 6.8, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query 1 VEEFAVSMRRQLDFGLEEKHLKLFRSNFGLSTD-PIPSDILPL 42 V++F V M Q+D E HL F NF D P + PL Sbjct 161 VQQFGVFMLSQVDLAREASHLSRFIYNFRRWKDVSFPKPVYPL 203 > YBR112c Length=966 Score = 26.9 bits (58), Expect = 9.5, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 0/36 (0%) Query 30 LSTDPIPSDILPLRNRCRRHSEPEQSDFLTAGPKAE 65 LST +P++ P+ + R+HS+ E + P E Sbjct 856 LSTATVPAEASPVEDEVRQHSKEENGTTEASAPSTE 891 > Hs4507831 Length=1050 Score = 26.9 bits (58), Expect = 9.9, Method: Compositional matrix adjust. Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 0/30 (0%) Query 46 CRRHSEPEQSDFLTAGPKAERHPTSIFGSL 75 CR HS P SD PK + PT G++ Sbjct 552 CRLHSAPNLSDLHVVRPKLPKPPTDPLGAV 581 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1192473466 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40