bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1027_orf1 Length=139 Score E Sequences producing significant alignments: (Bits) Value Hs7661998 49.3 2e-06 CE00855 44.3 7e-05 7299738 35.4 0.032 CE17829 34.7 0.060 Hs21361637 32.3 0.31 HsM8922635 32.0 0.39 At4g13730 31.2 0.65 Hs7706435 30.0 1.5 7303313 29.3 2.5 At1g77260 27.3 8.6 Hs15011904 27.3 9.1 > Hs7661998 Length=795 Score = 49.3 bits (116), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 0/51 (0%) Query 4 LPLVDYFAIAMLKFIRRQLLESDYSNCLRRLLKYPPIESVQCLVALSLAVR 54 L LVDY +AML +IR L+ S+Y CL L+ YP I V L+ +L +R Sbjct 362 LGLVDYIFVAMLLYIRDALISSNYQTCLGLLMHYPFIGDVHSLILKALFLR 412 > CE00855 Length=585 Score = 44.3 bits (103), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 12/81 (14%) Query 5 PLVDYFAIAMLKFIRRQLLESDYSNCLRRLLKYPPIESVQCLVALSLAVR---------- 54 PL +++L IR LL SDY CL+ L++YPPI + V L+ R Sbjct 326 PLAKCMFVSLLVQIRHLLLSSDYGGCLQYLMRYPPIADIDSFVKLARHYRNPKKNAKPMI 385 Query 55 KGTTLS--TASAAATPNSTNR 73 K S T + ++ PN T R Sbjct 386 KSNNFSHITVAGSSHPNRTQR 406 > 7299738 Length=654 Score = 35.4 bits (80), Expect = 0.032, Method: Compositional matrix adjust. Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 0/38 (0%) Query 1 AKKLPLVDYFAIAMLKFIRRQLLESDYSNCLRRLLKYP 38 + + L +Y +AML IR +LL SDY+ L L++YP Sbjct 347 SDRFDLPNYILVAMLVHIRDKLLLSDYTTSLTYLMRYP 384 > CE17829 Length=484 Score = 34.7 bits (78), Expect = 0.060, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query 2 KKLPLVDYFAIAMLKFIRRQLLESDYSNCLRRLLKYPPIESVQCLVALSLAVRKGTTL 59 ++ L+ Y +AM++ R L+ D+ C+R L YP + + +VA + +R G L Sbjct 396 QRFALLQYVCLAMMELKREPLINGDFPFCVRLLQNYPDTD-IAKIVAFAQDIRDGKAL 452 > Hs21361637 Length=400 Score = 32.3 bits (72), Expect = 0.31, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 13 AMLKFIRRQLLESDYSNCLRRLLKYPPIESVQCL 46 AML IR QLLE D++ +R L YP + Q L Sbjct 357 AMLMLIREQLLEGDFTVNMRLLQDYPITDVCQIL 390 > HsM8922635 Length=275 Score = 32.0 bits (71), Expect = 0.39, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 13 AMLKFIRRQLLESDYSNCLRRLLKYPPIESVQCL 46 AML IR QLLE D++ +R L YP + Q L Sbjct 232 AMLMLIREQLLEGDFTVNMRLLQDYPITDVCQIL 265 > At4g13730 Length=449 Score = 31.2 bits (69), Expect = 0.65, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 0/27 (0%) Query 13 AMLKFIRRQLLESDYSNCLRRLLKYPP 39 AML +RR+LL D+++ L+ L YPP Sbjct 407 AMLILVRRRLLAGDFTSNLKLLQNYPP 433 > Hs7706435 Length=543 Score = 30.0 bits (66), Expect = 1.5, Method: Composition-based stats. Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 7/74 (9%) Query 62 ASAAATPNSTNRRRDNSSNGINNHSSMDRSNSRTANASPAVQGPIRSPPGHPRFIQQPPP 121 A A N+ + S+ + SMDR NS+ A G RSP G P Q PP Sbjct 219 AEEAKKCRPPNKPQKGPSHDLPRRHSMDRQNSQEKAVGAAAYGA-RSPGGSPG--QSPPT 275 Query 122 ----LTPTIVSNPQ 131 L+P S P+ Sbjct 276 GYSILSPAHFSGPR 289 > 7303313 Length=1612 Score = 29.3 bits (64), Expect = 2.5, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 12/60 (20%) Query 77 NSSNGINNHS--SMDRSNSRTANASPAVQGPIRSPPG----------HPRFIQQPPPLTP 124 NS N +N++ + ++S T N S V PI PP H + I QPPP TP Sbjct 1454 NSRNSMNSYDRNHITGASSSTTNGSSMVAYPINPPPSPATRSRRPYRHYKIINQPPPPTP 1513 > At1g77260 Length=655 Score = 27.3 bits (59), Expect = 8.6, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 7/42 (16%) Query 93 SRTANASPAVQGPIRS-------PPGHPRFIQQPPPLTPTIV 127 S ++N + A+Q I S PP PR PPPL PT+V Sbjct 50 SSSSNVTEAIQTNITSVAAVAPSPPPRPRLKISPPPLPPTVV 91 > Hs15011904 Length=5430 Score = 27.3 bits (59), Expect = 9.1, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 0/47 (0%) Query 61 TASAAATPNSTNRRRDNSSNGINNHSSMDRSNSRTANASPAVQGPIR 107 +A + + +S + NS G+N S + + +T ASP GP R Sbjct 5384 SACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR 5430 Lambda K H 0.314 0.128 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1534984332 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40