bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1447_orf1 Length=98 Score E Sequences producing significant alignments: (Bits) Value Hs7662677 96.7 9e-21 SPCP1E11.08 84.3 4e-17 At5g06360 81.3 4e-16 CE20164 73.2 1e-13 7297688 68.2 4e-12 YER126c 57.4 7e-09 Hs14753972 45.8 2e-05 ECU11g0810 43.5 9e-05 Hs17455531 43.5 1e-04 Hs22046746 28.5 3.4 Hs20549382 28.1 4.2 At5g61890 28.1 4.6 YCL037c 27.3 7.5 > Hs7662677 Length=260 Score = 96.7 bits (239), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 48/81 (59%), Positives = 63/81 (77%), Gaps = 0/81 (0%) Query 18 ERKRKKAARTPHERSKTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGKQKEPETV 77 E+KRKK +R HERSK A+K+ G+KAKL++++R E+ QMK TIK HE++ KQK E Sbjct 22 EKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQMKKTIKMHEKRNTKQKNDEKT 81 Query 78 PEGAVPSYLLDREGASRTKIL 98 P+GAVP+YLLDREG SR K+L Sbjct 82 PQGAVPAYLLDREGQSRAKVL 102 > SPCP1E11.08 Length=260 Score = 84.3 bits (207), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 45/81 (55%), Positives = 57/81 (70%), Gaps = 0/81 (0%) Query 18 ERKRKKAARTPHERSKTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGKQKEPETV 77 ERKRKKAAR H+ S A+K RGIKAKL+ +R E+ QMK TIK HEE+ Q+ + Sbjct 22 ERKRKKAAREAHDASLYAQKTRGIKAKLYQEKRRKEKIQMKKTIKQHEERNATQRGSDAQ 81 Query 78 PEGAVPSYLLDREGASRTKIL 98 +GAVP+YLLDRE S+ K+L Sbjct 82 TQGAVPTYLLDREQESQAKML 102 > At5g06360 Length=260 Score = 81.3 bits (199), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 42/81 (51%), Positives = 55/81 (67%), Gaps = 0/81 (0%) Query 18 ERKRKKAARTPHERSKTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGKQKEPETV 77 ERKRKK AR H+ S A+K GIK K+ ++ + E+A MK T+K HEE ++K E V Sbjct 22 ERKRKKEAREVHKHSTMAQKSLGIKGKMIAKKNYAEKALMKKTLKMHEESSSRRKADENV 81 Query 78 PEGAVPSYLLDREGASRTKIL 98 EGAVP+YLLDRE +R K+L Sbjct 82 QEGAVPAYLLDREDTTRAKVL 102 > CE20164 Length=259 Score = 73.2 bits (178), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 39/82 (47%), Positives = 58/82 (70%), Gaps = 3/82 (3%) Query 18 ERKRKKAARTPHERSKTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGKQKEPETV 77 ER+RKK AR H+RS+ A+ LRG KAKL++++R+ E+ +M+ +K HEEK+ QK Sbjct 22 ERQRKKLARAAHDRSQMAKTLRGHKAKLYHKKRYSEKVEMRKLLKQHEEKD--QKNTVEQ 79 Query 78 PE-GAVPSYLLDREGASRTKIL 98 P+ GAVP+YLLDR+ + +L Sbjct 80 PDKGAVPAYLLDRQQQTSGTVL 101 > 7297688 Length=253 Score = 68.2 bits (165), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 46/81 (56%), Positives = 59/81 (72%), Gaps = 1/81 (1%) Query 18 ERKRKKAARTPHERSKTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGKQKEPETV 77 ERKRKK AR P +R++ ARKLRGIKAKLFN+ R E+ Q+K I+ HEEK+ +K+ E V Sbjct 16 ERKRKKEARLPKDRARKARKLRGIKAKLFNKERRNEKIQIKKKIQAHEEKK-VKKQEEKV 74 Query 78 PEGAVPSYLLDREGASRTKIL 98 +GA+P YLLDR S K+L Sbjct 75 EDGALPHYLLDRGIQSSAKVL 95 > YER126c Length=261 Score = 57.4 bits (137), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Query 18 ERKRKKAARTPHERSKTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGK-QKEPET 76 ERKRK+ AR H+ S+ A+KL G K K F ++R+ E+ M+ IK HE+ + K +P Sbjct 22 ERKRKREARESHKISERAQKLTGWKGKQFAKKRYAEKVSMRKKIKAHEQSKVKGSSKPLD 81 Query 77 VPEGAVPSYLLDRE 90 A+P+YLLDRE Sbjct 82 TDGDALPTYLLDRE 95 > Hs14753972 Length=194 Score = 45.8 bits (107), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%) Query 64 HEEKEGKQKEPETVPEGAVPSYLLDREGASRTKIL 98 HE++ KQK E P+GAVP+YLLDRE SR K+L Sbjct 2 HEKRNIKQKNDEKTPQGAVPAYLLDREEQSRAKVL 36 > ECU11g0810 Length=258 Score = 43.5 bits (101), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 4/79 (5%) Query 19 RKRKKAARTPHERSKTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGKQKEPE-TV 77 RK KK R +KTA++L G+KAKLF +++ + Q+K +K KE K+K E +V Sbjct 23 RKYKKERRNEKLVAKTAKRLFGLKAKLFAKKQHAAKIQLKKDLKM---KESKKKGMEVSV 79 Query 78 PEGAVPSYLLDREGASRTK 96 + +P +LLDRE R + Sbjct 80 EDNPLPHFLLDREMQERAR 98 > Hs17455531 Length=188 Score = 43.5 bits (101), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/29 (65%), Positives = 23/29 (79%), Gaps = 0/29 (0%) Query 70 KQKEPETVPEGAVPSYLLDREGASRTKIL 98 K+K E P+GAVP+YLLDREG SR K+L Sbjct 8 KKKNAEKTPQGAVPAYLLDREGQSRAKVL 36 > Hs22046746 Length=223 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 60 TIKHHEEKEGKQKEPETVPEGAV 82 +KHH E ++ EP+T P+G + Sbjct 19 VLKHHNEAPDEESEPDTCPQGGL 41 > Hs20549382 Length=435 Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query 48 RRRFVEQAQMKTTIKHHEEKEGKQKEPETVPEGAVP 83 +R F EQ + KH +E+ G K+P PEGA P Sbjct 29 QRLFPEQRACSSRGKHGDER-GAPKDPPAAPEGAFP 63 > At5g61890 Length=248 Score = 28.1 bits (61), Expect = 4.6, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 4/46 (8%) Query 33 KTARKLRGIKAKLFNRRRFVEQAQMKTTIKHHEEKEGKQKEPETVP 78 + A K +G KAKL F E+ Q+ + ++ + Q EP+++P Sbjct 131 EAALKFKGSKAKL----NFPERVQLGSNSTYYSSNQIPQMEPQSIP 172 > YCL037c Length=466 Score = 27.3 bits (59), Expect = 7.5, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query 6 LLPTFFPFSNTA----ERKRKKAARTPHERSKTARKLRGIKAKL 45 L PT P S + + RKK RTP +S TA K IKA + Sbjct 76 LAPTEIPVSTISIEDLDATRKKKNRTPTPKSSTATKWVPIKASI 119 Lambda K H 0.315 0.129 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194657780 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40