bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1630_orf2 Length=66 Score E Sequences producing significant alignments: (Bits) Value At4g39220 90.1 9e-19 At2g23310 87.4 5e-18 At2g21600 87.4 6e-18 YCL001w 84.0 6e-17 CE03349 81.3 4e-16 7301302 81.3 5e-16 SPAC22E12.05c 75.9 2e-14 At2g18240_1 66.2 1e-11 ECU08g0700 47.0 9e-06 Hs17864092 28.9 2.2 CE23037 28.9 2.7 Hs20481788 28.5 3.1 > At4g39220 Length=191 Score = 90.1 bits (222), Expect = 9e-19, Method: Compositional matrix adjust. Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W S +A IA MTFF VFD+PVFWPILL Y+I+LF+LTM++Q+ MIKYKY+PFS Sbjct 115 FKFWYSMTKAFCIAFLMTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPFS 174 Query 61 WGKQTY 66 +GKQ Y Sbjct 175 FGKQKY 180 > At2g23310 Length=211 Score = 87.4 bits (215), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 39/64 (60%), Positives = 55/64 (85%), Gaps = 0/64 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W+S +RA +I MTFF+VFD+PVFWPILL Y+++LF LTM++Q++ MIKY+Y+PFS Sbjct 136 FKFWLSIIRAFIIGFMMTFFEVFDVPVFWPILLFYWVMLFFLTMRKQIQHMIKYRYVPFS 195 Query 61 WGKQ 64 +GK+ Sbjct 196 FGKK 199 > At2g21600 Length=195 Score = 87.4 bits (215), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 41/66 (62%), Positives = 52/66 (78%), Gaps = 0/66 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W S +A IA MTFF VFD+PVFWPILL Y+++LF+LTM++Q+ MIK+KY+PFS Sbjct 114 FKFWYSMTKAFCIAFLMTFFSVFDVPVFWPILLCYWVVLFVLTMRRQIAHMIKHKYIPFS 173 Query 61 WGKQTY 66 GKQ Y Sbjct 174 IGKQKY 179 > YCL001w Length=188 Score = 84.0 bits (206), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 36/66 (54%), Positives = 53/66 (80%), Gaps = 0/66 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W + +RA +I++ ++ F +FD+PVFWPILL+YFILLF LTM++Q++ MIKY+Y+P Sbjct 118 FKFWYNSIRATVISLLLSLFSIFDIPVFWPILLMYFILLFFLTMRRQIQHMIKYRYIPLD 177 Query 61 WGKQTY 66 GK+ Y Sbjct 178 IGKKKY 183 > CE03349 Length=191 Score = 81.3 bits (199), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 38/63 (60%), Positives = 51/63 (80%), Gaps = 0/63 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W S M+A LIAI+ TFF+ FD+PVFWPIL++YF +L LT+K+Q+ MIKY+Y+PF+ Sbjct 114 FKFWHSFMKATLIAITCTFFEFFDVPVFWPILVMYFFILTFLTLKRQIMHMIKYRYIPFT 173 Query 61 WGK 63 GK Sbjct 174 VGK 176 > 7301302 Length=203 Score = 81.3 bits (199), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 38/66 (57%), Positives = 50/66 (75%), Gaps = 0/66 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W+S ++ LI + TFF F++PVFWPIL++YFI LF +TMK+Q+K MIKYKYLPF+ Sbjct 119 FKFWLSVAKSTLIGLICTFFDFFNVPVFWPILVMYFITLFCITMKRQIKHMIKYKYLPFT 178 Query 61 WGKQTY 66 K Y Sbjct 179 RNKPRY 184 > SPAC22E12.05c Length=184 Score = 75.9 bits (185), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 31/66 (46%), Positives = 50/66 (75%), Gaps = 0/66 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W S MRA L A+ +FF++FD+PVFWPIL++Y+++L ++Q++ M+KY+Y+PF Sbjct 116 FKFWYSSMRATLFALVASFFRIFDVPVFWPILVVYYLVLSFFCFRRQIQHMLKYRYVPFD 175 Query 61 WGKQTY 66 GK+ + Sbjct 176 IGKKKF 181 > At2g18240_1 Length=180 Score = 66.2 bits (160), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 0/63 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 FK W + +A ++A MTFF D+PVFWPILL Y+++L+ LTMK+ + M KY+Y PF Sbjct 118 FKFWYAATKAFVVAFVMTFFSFLDVPVFWPILLCYWLVLYSLTMKRLIVHMFKYRYFPFD 177 Query 61 WGK 63 K Sbjct 178 VRK 180 > ECU08g0700 Length=166 Score = 47.0 bits (110), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 0/66 (0%) Query 1 FKAWVSGMRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYKYLPFS 60 F W+ + + +A+ T+F + D+PV+ PIL++YFI + T K+ + M KY Y PF Sbjct 99 FDFWMFVTKIVGMALIGTYFGILDVPVYTPILVVYFIFMVGYTAKRLIAHMKKYNYNPFL 158 Query 61 WGKQTY 66 K+ Y Sbjct 159 QSKEYY 164 > Hs17864092 Length=4024 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Query 7 GMRALLIAISMTFFQVFDLPVFWPIL---LIYFILLFILTMKQQVKKMIKYKYL 57 G R + I S+ FF + DL P+ L +FI LFIL+++ K I K L Sbjct 3202 GYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRL 3255 > CE23037 Length=1144 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 3/44 (6%) Query 8 MRALLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKM 51 M +LI+IS F V P+ IL+ YF++++ + +Q+K++ Sbjct 711 MILVLISISTPIFLVCAAPL---ILIYYFVMIYYIPTSRQLKRL 751 > Hs20481788 Length=543 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 0/45 (0%) Query 11 LLIAISMTFFQVFDLPVFWPILLIYFILLFILTMKQQVKKMIKYK 55 +L + S F+ +F LP +P+LLI+ + Q+ K Y+ Sbjct 219 MLCSFSHLFYPLFHLPTLFPLLLIFLANVTFNYSNQKPKPSTSYQ 263 Lambda K H 0.338 0.147 0.489 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1163608362 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40