bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1653_orf1 Length=68 Score E Sequences producing significant alignments: (Bits) Value At4g11600 68.9 2e-12 At1g63460 68.2 3e-12 At2g48150 67.4 7e-12 7292354 66.6 1e-11 At3g63080 66.6 1e-11 At2g31570 66.2 1e-11 YBR244w 66.2 1e-11 Hs15618997 65.5 2e-11 At2g43350 64.7 4e-11 CE09696 63.2 1e-10 At4g31870 62.4 2e-10 At2g25080 62.4 2e-10 CE18107 61.2 4e-10 SPBC32F12.03c 60.1 1e-09 YIR037w 60.1 1e-09 CE08101 58.5 3e-09 CE17231 56.6 1e-08 CE08102 54.7 4e-08 ECU02g0440 53.1 1e-07 CE25634 52.4 2e-07 7302524 52.0 3e-07 CE07402 51.6 4e-07 YKL026c 50.1 1e-06 Hs10834976 50.1 1e-06 Hs4504107 43.1 1e-04 Hs4504103 41.2 5e-04 Hs4557629 39.7 0.001 Hs6006001 38.5 0.003 Hs6715602 28.9 2.3 7296736 28.1 3.8 Hs14740408 27.7 5.2 YDR453c 27.7 5.3 At5g53140 27.3 7.1 Hs4507745 26.9 9.1 > At4g11600 Length=169 Score = 68.9 bits (167), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 0/65 (0%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 Y K AKG ++ + YKGKVLLI N A++CG T + E ++ EKY GFEILAF Sbjct 10 LYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYKGHGFEILAF 69 Query 63 PTLQF 67 P QF Sbjct 70 PCNQF 74 > At1g63460 Length=167 Score = 68.2 bits (165), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 0/64 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 Y L + AKG + + YK KVLLI N A+KCG T + E +E+ +Y D+G EILAFP Sbjct 10 YELSIEDAKGNNLALSQYKDKVLLIVNVASKCGMTNSNYTELNELYNRYKDKGLEILAFP 69 Query 64 TLQF 67 QF Sbjct 70 CNQF 73 > At2g48150 Length=171 Score = 67.4 bits (163), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 31/60 (51%), Positives = 41/60 (68%), Gaps = 0/60 (0%) Query 8 AKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFPTLQF 67 K + G+++ M Y+GKVLLI N A+KCGFT+ + + E+ KY DQ FEILAFP QF Sbjct 17 VKDSSGKDLNMSIYQGKVLLIVNVASKCGFTETNYTQLTELYRKYKDQDFEILAFPCNQF 76 > 7292354 Length=169 Score = 66.6 bits (161), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/65 (43%), Positives = 42/65 (64%), Gaps = 0/65 (0%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 Y K G ++ ++ YKGKV+L+ N A+KCG TK + ++ ++KEKYG++G IL F Sbjct 13 IYEFTVKDTHGNDVSLEKYKGKVVLVVNIASKCGLTKNNYEKLTDLKEKYGERGLVILNF 72 Query 63 PTLQF 67 P QF Sbjct 73 PCNQF 77 > At3g63080 Length=173 Score = 66.6 bits (161), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%) Query 8 AKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFPTLQF 67 K + G+E+ + Y+GKVLL+ N A+KCGFT+ + + E+ KY DQGF +LAFP QF Sbjct 19 VKDSSGKEVDLSVYQGKVLLVVNVASKCGFTESNYTQLTELYRKYKDQGFVVLAFPCNQF 78 > At2g31570 Length=169 Score = 66.2 bits (160), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 0/65 (0%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 Y K G ++ + YKGK LL+ N A+KCG T + KE + + EKY +QG EILAF Sbjct 9 IYDFTVKDIGGNDVSLDQYKGKTLLVVNVASKCGLTDANYKELNVLYEKYKEQGLEILAF 68 Query 63 PTLQF 67 P QF Sbjct 69 PCNQF 73 > YBR244w Length=162 Score = 66.2 bits (160), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 35/65 (53%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 FY L+ K KGE KGKV+LI N A+KCGFT Q+ KE E+ +KY D+GF IL F Sbjct 5 FYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQY-KELEELYKKYQDKGFVILGF 63 Query 63 PTLQF 67 P QF Sbjct 64 PCNQF 68 > Hs15618997 Length=187 Score = 65.5 bits (158), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 0/66 (0%) Query 2 DFYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILA 61 DFY KA +G+ + ++ Y+G V L+ N A++CGFT QH + +++ G F +LA Sbjct 24 DFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLA 83 Query 62 FPTLQF 67 FP QF Sbjct 84 FPCNQF 89 > At2g43350 Length=206 Score = 64.7 bits (156), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 0/64 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 Y++ K +G+++ + + GKVLLI N A+KCG T + KE + + KY QGFEILAFP Sbjct 49 YNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAFP 108 Query 64 TLQF 67 QF Sbjct 109 CNQF 112 > CE09696 Length=163 Score = 63.2 bits (152), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 0/64 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 Y K A G+++ + YKGKVL+I N A++CG T ++ + E+ + Y G E+LAFP Sbjct 5 YDFNVKNANGDDVSLSDYKGKVLIIVNVASQCGLTNKNYTQLKELLDVYKKDGLEVLAFP 64 Query 64 TLQF 67 QF Sbjct 65 CNQF 68 > At4g31870 Length=230 Score = 62.4 bits (150), Expect = 2e-10, Method: Composition-based stats. Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 0/64 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 + K G ++ + +KGK LLI N A++CG T + E ++ EKY +QGFEILAFP Sbjct 77 HDFTVKDIDGNDVSLDKFKGKPLLIVNVASRCGLTSSNYSELSQLYEKYKNQGFEILAFP 136 Query 64 TLQF 67 QF Sbjct 137 CNQF 140 > At2g25080 Length=236 Score = 62.4 bits (150), Expect = 2e-10, Method: Composition-based stats. Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 0/64 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 + K G+++ + +KGKV+LI N A++CG T + E + EKY QGFEILAFP Sbjct 80 HDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKTQGFEILAFP 139 Query 64 TLQF 67 QF Sbjct 140 CNQF 143 > CE18107 Length=163 Score = 61.2 bits (147), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 0/64 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 + + K A+GE+ + Y+GKVL+I N A++CG T + +F E+ + Y G E+LAFP Sbjct 5 HGITVKNAQGEDTPLSNYQGKVLIIVNVASQCGLTNSNYNQFKELLDVYKKDGLEVLAFP 64 Query 64 TLQF 67 QF Sbjct 65 CNQF 68 > SPBC32F12.03c Length=158 Score = 60.1 bits (144), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/65 (47%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 FY L K G KGKV+L+ NTA+KCGFT Q+ K + +KY D+GF IL F Sbjct 4 FYDLAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFTPQY-KGLEALYQKYKDRGFIILGF 62 Query 63 PTLQF 67 P QF Sbjct 63 PCNQF 67 > YIR037w Length=163 Score = 60.1 bits (144), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Query 2 DFYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILA 61 +FY L KG+ KGKV+LI N A+KCGFT Q+ KE + ++Y D+GF I+ Sbjct 3 EFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQY-KELEALYKRYKDEGFTIIG 61 Query 62 FPTLQF 67 FP QF Sbjct 62 FPCNQF 67 > CE08101 Length=223 Score = 58.5 bits (140), Expect = 3e-09, Method: Composition-based stats. Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 Y + +T +GE + Y+G+VLL+ N AT C +T+Q+ +F+ + EKY QGF ++AFP Sbjct 41 YDFQVETLQGEYTDLSQYRGQVLLMVNVATFCAYTQQY-TDFNPLIEKYQSQGFTLIAFP 99 Query 64 TLQF 67 QF Sbjct 100 CNQF 103 > CE17231 Length=188 Score = 56.6 bits (135), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 24/65 (36%), Positives = 39/65 (60%), Gaps = 0/65 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 Y +AK G+ + M+ Y+ KV+L +N A+ CG+T + F E+ Y ++GF + AFP Sbjct 32 YQFQAKNIDGKMVSMEKYRDKVVLFTNVASYCGYTDSNYNAFKELDGIYREKGFRVAAFP 91 Query 64 TLQFK 68 QF+ Sbjct 92 CNQFE 96 > CE08102 Length=224 Score = 54.7 bits (130), Expect = 4e-08, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 + + +T +GE + Y+GKV+L+ N AT C +T+Q+ +F+ + EKY QG ++AFP Sbjct 42 FDFQIETLQGEYTDLSQYRGKVILLVNVATFCAYTQQY-TDFNPMLEKYQAQGLTLVAFP 100 Query 64 TLQF 67 QF Sbjct 101 CNQF 104 > ECU02g0440 Length=177 Score = 53.1 bits (126), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 0/65 (0%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 FY L A+ G E+ + +++G V++I+N A+ C F + + K F + +K+ +G IL F Sbjct 10 FYGLSARGWDGSEVSLGSFRGCVIMIANVASSCKFAESNYKSFAGLLDKFYRKGLRILLF 69 Query 63 PTLQF 67 P Q+ Sbjct 70 PCNQY 74 > CE25634 Length=199 Score = 52.4 bits (124), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 + + +T KG+ + Y+GKV L+ N AT C +T+Q+ +F+ I +KY QG I AFP Sbjct 41 FDFQIETLKGDYTDLSQYRGKVTLLVNVATFCAYTQQY-TDFNPILDKYQKQGLVIAAFP 99 Query 64 TLQF 67 QF Sbjct 100 CNQF 103 > 7302524 Length=160 Score = 52.0 bits (123), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 0/67 (0%) Query 1 MDFYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEIL 60 + ++L + G + + + G VLLI N A+KCG T + E+Y DQG IL Sbjct 5 LTIHALTVRDTFGNPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRIL 64 Query 61 AFPTLQF 67 FP QF Sbjct 65 NFPCNQF 71 > CE07402 Length=193 Score = 51.6 bits (122), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 0/64 (0%) Query 4 YSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFP 63 Y + G+ + + Y G V++I N A+ CG T + KE + +KY +G + AFP Sbjct 34 YDFSVRDNSGDLVSLDKYSGLVVIIVNVASYCGLTNSNYKELKSLNDKYHLRGLRVAAFP 93 Query 64 TLQF 67 QF Sbjct 94 CNQF 97 > YKL026c Length=167 Score = 50.1 bits (118), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/66 (39%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query 2 DFYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILA 61 +FYS G + + KV+LI N A+ C FT Q+ KE + EKY G I+A Sbjct 3 EFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQY-KELEYLYEKYKSHGLVIVA 61 Query 62 FPTLQF 67 FP QF Sbjct 62 FPCGQF 67 > Hs10834976 Length=201 Score = 50.1 bits (118), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Query 4 YSLKAKT-AKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 Y+ A+ A GE + + + +GKVLLI N A+ G T + + +E++ + G +G +L F Sbjct 15 YAFSARPLAGGEPVSLGSLRGKVLLIENVASLXGTTVRDYTQMNELQRRLGPRGLVVLGF 74 Query 63 PTLQF 67 P QF Sbjct 75 PCNQF 79 > Hs4504107 Length=197 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 0/65 (0%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 + AK G + + Y+G V +++N A++ G T+ + + ++ +Y + G ILAF Sbjct 41 MHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQXGKTEVNYTQLVDLHARYAECGLRILAF 100 Query 63 PTLQF 67 P QF Sbjct 101 PCNQF 105 > Hs4504103 Length=190 Score = 41.2 bits (95), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Query 3 FYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 FY L A + GE++ ++G+ +LI N A+ G T + + +E++ ++ + +L F Sbjct 8 FYDLSAISLDGEKVDFNTFRGRAVLIENVASLXGTTTRDFTQLNELQCRFPRR-LVVLGF 66 Query 63 PTLQF 67 P QF Sbjct 67 PCNQF 71 > Hs4557629 Length=221 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query 12 KGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAFPTLQF 67 K E + + Y GK +L N AT CG T Q+ E + ++E+ G +L FP QF Sbjct 50 KNEYVSFKQYVGKHILFVNVATYCGLTAQY-PELNALQEELKPYGLVVLGFPCNQF 104 > Hs6006001 Length=226 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Query 4 YSLKAKTAKGEE-ICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEILAF 62 Y A T GEE I + Y GK +L N A+ G T Q++ E + ++E+ G IL F Sbjct 41 YEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI-ELNALQEELAPFGLVILGF 99 Query 63 PTLQF 67 P QF Sbjct 100 PCNQF 104 > Hs6715602 Length=100 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 0/30 (0%) Query 12 KGEEICMQAYKGKVLLISNTATKCGFTKQH 41 K E + + Y GK +L N AT CG T Q+ Sbjct 50 KNEYVSFKQYVGKHILFVNVATYCGLTAQY 79 > 7296736 Length=2837 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Query 5 SLKAKTAKGEEICMQAYKGKVL----LISNTATKCGFTKQHLKEFHEIKEKYG 53 SL A A GE+I +++ + ++L LI N +T+ K H+ E + K++ G Sbjct 2772 SLAAVDADGEQIELRSMQAQLLDTQLLIKNLSTQLHELKDHMTEQRKQKQRLG 2824 > Hs14740408 Length=105 Score = 27.7 bits (60), Expect = 5.2, Method: Compositional matrix adjust. Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 17/77 (22%) Query 6 LKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGF-------- 57 +++KTA E + A K++++ +AT CG K FH + EKY + F Sbjct 5 IESKTAFQEA--LDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDC 62 Query 58 -------EILAFPTLQF 67 E+ PT QF Sbjct 63 QDVASECEVKCMPTFQF 79 > YDR453c Length=196 Score = 27.7 bits (60), Expect = 5.3, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query 14 EEICMQAYKGKVLLISNTATKCGFT-KQHLKEFHEIKEKYGDQGFEIL 60 EEI ++ YKGK ++++ F + F + +K+ DQG ++L Sbjct 23 EEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQVL 70 > At5g53140 Length=307 Score = 27.3 bits (59), Expect = 7.1, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 13/17 (76%), Gaps = 0/17 (0%) Query 2 DFYSLKAKTAKGEEICM 18 DFY +KA T +G+ +CM Sbjct 3 DFYDIKASTIEGQAVCM 19 > Hs4507745 Length=105 Score = 26.9 bits (58), Expect = 9.1, Method: Compositional matrix adjust. Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 17/77 (22%) Query 6 LKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGF-------- 57 +++KTA E + A K++++ +AT CG K FH + EKY + F Sbjct 5 IESKTAFQEA--LDAAGDKLVVVDFSATWCGPCKMINPFFHSLSEKYSNVIFLEVDVDDC 62 Query 58 -------EILAFPTLQF 67 E+ PT QF Sbjct 63 QDVASECEVKCTPTFQF 79 Lambda K H 0.321 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1203543208 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40