bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1872_orf1 Length=134 Score E Sequences producing significant alignments: (Bits) Value SPBP8B7.20c 31.2 0.56 At4g13730 30.0 1.4 At5g55920 29.6 1.6 Hs5453792 29.3 2.3 Hs20556018 28.9 2.7 Hs22060661 28.9 3.2 At4g26600 28.9 3.2 7296950 28.5 3.9 At2g30840 28.1 4.9 CE26977 28.1 5.0 CE26976 28.1 5.0 At1g65060 27.3 7.6 > SPBP8B7.20c Length=608 Score = 31.2 bits (69), Expect = 0.56, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 95 PVYLRTNTLTITRDRLYHYLLNKGVAVE 122 PV +RTNTL R L L+N+GV +E Sbjct 264 PVTIRTNTLKTQRRELAQALINRGVNLE 291 > At4g13730 Length=449 Score = 30.0 bits (66), Expect = 1.4, Method: Compositional matrix adjust. Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 18/93 (19%) Query 20 VKWKGLLDHITPPPANWPSRIRTYFVSDRWKLQAQNERLPASVRTSFPAELFRRIEASHG 79 + WK LLD+++P + W S + K ++Q ++ + + P+E+ R+++ S G Sbjct 134 IVWKLLLDYLSPDRSLWSSELA--------KKRSQYKQFKEELLMN-PSEVTRKMDKSKG 184 Query 80 TDK---------AIHICNILNEEAPVYLRTNTL 103 D A+ I +E+ P+ L T +L Sbjct 185 GDSNDPKIESPGALSRSEITHEDHPLSLGTTSL 217 > At5g55920 Length=682 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 13/56 (23%) Query 67 PAELFRRIEASHGTDKAIHICNILNEEAPVYLRTNTLTITRDRLYHYLLNKGVAVE 122 P EL IEA ++ P +RTNTL R L LLN+GV ++ Sbjct 269 PGELMELIEA-------------FEKQRPTSIRTNTLKTRRRDLADVLLNRGVNLD 311 > Hs5453792 Length=855 Score = 29.3 bits (64), Expect = 2.3, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 95 PVYLRTNTLTITRDRLYHYLLNKGVAVE 122 PV LRTNTL R L L+N+GV ++ Sbjct 309 PVTLRTNTLKTRRRDLAQALINRGVNLD 336 > Hs20556018 Length=812 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 95 PVYLRTNTLTITRDRLYHYLLNKGVAVE 122 PV LRTNTL R L L+N+GV ++ Sbjct 309 PVTLRTNTLKTRRRDLAQALINRGVNLD 336 > Hs22060661 Length=388 Score = 28.9 bits (63), Expect = 3.2, Method: Compositional matrix adjust. Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 11/85 (12%) Query 8 DKKFITEHIYQIVKWKGLLDHITPPPANWPSRIRTYFVSDRWKLQAQNERLPASVRTSFP 67 + +F T + V G+ +H++PPP PS I + R + E + +R +F Sbjct 99 NNEFATRTPNKAVHVCGIYEHVSPPP---PSDIAMLMLPVRSFTVSAGEFPGSLLRKAFS 155 Query 68 AELFRRIEASHGTDKAIHICNILNE 92 EL R+ +HIC+ E Sbjct 156 RELSSRLH--------VHICSFQGE 172 > At4g26600 Length=626 Score = 28.9 bits (63), Expect = 3.2, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 14/69 (20%) Query 55 NERLPASVRTSFPA-ELFRRIEASHGTDKAIHICNILNEEAPVYLRTNTLTITRDRLYHY 113 NE L ++ FP EL IEA ++ P +RTNTL R L Sbjct 239 NEFLIGTLIEMFPVVELMELIEA-------------FEKKRPTSIRTNTLKTRRRDLADI 285 Query 114 LLNKGVAVE 122 LLN+GV ++ Sbjct 286 LLNRGVNLD 294 > 7296950 Length=7182 Score = 28.5 bits (62), Expect = 3.9, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 0/44 (0%) Query 19 IVKWKGLLDHITPPPANWPSRIRTYFVSDRWKLQAQNERLPASV 62 + K K L DHI +N P+R + D L A E+ AS+ Sbjct 3673 VAKLKSLEDHIEQQASNIPARSKEVMARDLANLHADFEKFGASL 3716 > At2g30840 Length=362 Score = 28.1 bits (61), Expect = 4.9, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 0/39 (0%) Query 9 KKFITEHIYQIVKWKGLLDHITPPPANWPSRIRTYFVSD 47 KKF T + + VK+ D + P ANW + + D Sbjct 122 KKFYTRDVTKTVKYNSNFDLYSSPSANWRDTLSCFMAPD 160 > CE26977 Length=4450 Score = 28.1 bits (61), Expect = 5.0, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query 30 TPPPANWPSRIRTYFVSDRWKLQAQNERLPASVRT-SFPAELFRRIE 75 T P W +IRT V D K QA S+ T S P E+F +E Sbjct 2997 TQPGTKWDVKIRTQTVEDSGKPQASRWSDRVSITTQSLPGEIFVTVE 3043 > CE26976 Length=4280 Score = 28.1 bits (61), Expect = 5.0, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query 30 TPPPANWPSRIRTYFVSDRWKLQAQNERLPASVRT-SFPAELFRRIE 75 T P W +IRT V D K QA S+ T S P E+F +E Sbjct 2997 TQPGTKWDVKIRTQTVEDSGKPQASRWSDRVSITTQSLPGEIFVTVE 3043 > At1g65060 Length=561 Score = 27.3 bits (59), Expect = 7.6, Method: Compositional matrix adjust. Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 4/63 (6%) Query 4 VGSNDKKFITEHIYQIVKWKGLLDHITPPPANWPSRIRTYFVSDRWKLQAQNERLPASVR 63 V +D+ FI + + +++K+KG PPA S + + + QN+ + V Sbjct 448 VDEDDEIFIVDRLKEVIKFKGF----QVPPAELESLLINHHSIADAAVVPQNDEVAGEVP 503 Query 64 TSF 66 +F Sbjct 504 VAF 506 Lambda K H 0.319 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1393086308 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40