bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2002_orf1 Length=75 Score E Sequences producing significant alignments: (Bits) Value 7299193 40.8 6e-04 SPCC4G3.06c 40.8 6e-04 At1g07830 38.1 0.004 CE07706 37.4 0.008 YLR439w 35.4 0.028 7293454 28.9 2.6 YKL039w 27.7 5.0 At1g06870 27.3 6.7 > 7299193 Length=182 Score = 40.8 bits (94), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%) Query 29 GDAWPNKLLKNKSFQDLHALWFVLLKEKNLLL 60 G AW + L+ KS ++LH LWFVLLKE+N+LL Sbjct 32 GRAWRTEELRIKSNKELHQLWFVLLKERNMLL 63 > SPCC4G3.06c Length=144 Score = 40.8 bits (94), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 19/35 (54%), Positives = 24/35 (68%), Gaps = 0/35 (0%) Query 29 GDAWPNKLLKNKSFQDLHALWFVLLKEKNLLLGER 63 G AW + L+ KSF DLH LW+ L+EKNLL +R Sbjct 58 GRAWAAEELRWKSFNDLHGLWYNCLREKNLLFTQR 92 > At1g07830 Length=144 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 0/37 (0%) Query 27 ISGDAWPNKLLKNKSFQDLHALWFVLLKEKNLLLGER 63 + G W L+ KS+ DL LW+VLLKEKN+L+ +R Sbjct 55 VYGRGWKASELRLKSWDDLQKLWYVLLKEKNMLMTQR 91 > CE07706 Length=252 Score = 37.4 bits (85), Expect = 0.008, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 29 GDAWPNKLLKNKSFQDLHALWFVLLKEKNLLL 60 G +W + L+ KS DLH LW+V LKE+N+L+ Sbjct 85 GRSWTAEELRLKSNSDLHKLWYVCLKERNMLI 116 > YLR439w Length=319 Score = 35.4 bits (80), Expect = 0.028, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 21/26 (80%), Gaps = 0/26 (0%) Query 37 LKNKSFQDLHALWFVLLKEKNLLLGE 62 L++KSF DLH+LW+ L+E+N+L E Sbjct 98 LRHKSFNDLHSLWYNCLREQNVLARE 123 > 7293454 Length=963 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 32 WPNKLLKNKSFQDLHALWFVLLKEKNL 58 W NK+ N SF DLH LLK N+ Sbjct 859 WENKVTVNTSFTDLHEYLKHLLKSTNM 885 > YKL039w Length=531 Score = 27.7 bits (60), Expect = 5.0, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query 6 ELWKGGYLDPNISASIKKELSISGDAWPNKLLKNKSFQDLHALWFVLLKEKNLLLGERWA 65 E WKG +DP IS ++KK +S ++ P ++ FQD L L E+ + + +A Sbjct 46 EDWKGK-IDPFISFNLKKISGLSDESDPGLVVAIYDFQDFEHLGVQLPDEEMYYICDDYA 104 > At1g06870 Length=367 Score = 27.3 bits (59), Expect = 6.7, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query 4 IDELWKGGYL-DPNISASIKKELSISGDAWPNKLL 37 I E+ +GG + DP + + ++S G+ W NKLL Sbjct 146 IAEVDRGGKVCDPKVKLELSDKVSNGGNGWVNKLL 180 Lambda K H 0.317 0.134 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181410888 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40