bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2040_orf1 Length=113 Score E Sequences producing significant alignments: (Bits) Value SPBC1773.11c 40.8 6e-04 7293231 39.7 0.001 YNL323w 37.4 0.007 YCR094w 37.0 0.008 YNR048w 35.0 0.030 Hs18597131 33.9 0.075 At1g79450 33.5 0.098 SPBC11B10.07c 33.1 0.13 CE07425 32.3 0.21 At5g46150 30.8 0.56 At5g11040 30.0 0.95 Hs22063139_1 30.0 1.1 7293430 30.0 1.2 YLR163c 29.6 1.3 At1g54320 28.9 2.2 Hs8922720 28.9 2.4 CE04378 28.5 2.9 CE27123 28.5 2.9 7294826 28.5 3.0 At3g12740 28.5 3.1 At2g25370 28.5 3.4 HsM7710141_2 28.5 3.6 HsM7710139_2 28.1 3.9 At4g16440_2 27.7 5.2 HsM7710137_2 27.3 6.4 CE27737 27.3 6.9 Hs20540861 27.3 7.7 Hs17465835 26.9 9.7 > SPBC1773.11c Length=396 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 15/29 (51%), Positives = 23/29 (79%), Gaps = 0/29 (0%) Query 82 FMQQRMSAWEPLLTPRRILFVLFGVGLIF 110 F QQR+ +W+PLLTP+ +L + F +G+IF Sbjct 29 FRQQRIKSWQPLLTPKIVLPLFFVLGIIF 57 > 7293231 Length=357 Score = 39.7 bits (91), Expect = 0.001, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 0/36 (0%) Query 76 RAALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIFV 111 R + F QQR+ AW+P+LT R +L F +G++F+ Sbjct 18 RPSDSAFKQQRLPAWQPVLTARTVLPTFFVIGVLFI 53 > YNL323w Length=414 Score = 37.4 bits (85), Expect = 0.007, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 0/38 (0%) Query 76 RAALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIFVVL 113 R D F QQR++A P+LTPR +L + + ++FV++ Sbjct 52 RPKEDAFTQQRLAAINPVLTPRTVLPLYLLIAVVFVIV 89 > YCR094w Length=391 Score = 37.0 bits (84), Expect = 0.008, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 82 FMQQRMSAWEPLLTPRRILFVLFGVGLIF 110 F QQR+ AW+P+L+P+ +L +L V IF Sbjct 28 FRQQRLKAWQPILSPQSVLPLLIFVACIF 56 > YNR048w Length=393 Score = 35.0 bits (79), Expect = 0.030, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 76 RAALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIF 110 + A F QQR+ AW+P+L+P+ +L +L + +F Sbjct 24 KPANTSFRQQRLKAWQPILSPQSVLPLLILMACVF 58 > Hs18597131 Length=351 Score = 33.9 bits (76), Expect = 0.075, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 0/32 (0%) Query 82 FMQQRMSAWEPLLTPRRILFVLFGVGLIFVVL 113 F QQR+ AW+PLL+ L + F GL F+ L Sbjct 18 FTQQRLPAWQPLLSASIALPLFFCAGLAFIGL 49 > At1g79450 Length=350 Score = 33.5 bits (75), Expect = 0.098, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 76 RAALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIFVVL 113 R F QQ + A +P+LTPR ++ G++F+ L Sbjct 27 RPKYSRFTQQELPACKPILTPRWVILTFLVAGVVFIPL 64 > SPBC11B10.07c Length=371 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 0/32 (0%) Query 82 FMQQRMSAWEPLLTPRRILFVLFGVGLIFVVL 113 F+QQ + AW+ + TP +L +LF +G++F L Sbjct 23 FVQQTLPAWQFIFTPWTVLPLLFLLGIVFAPL 54 > CE07425 Length=348 Score = 32.3 bits (72), Expect = 0.21, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 75 SRAALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIFV 111 +R QQ++ AW+P+LT ++ +F +G IF+ Sbjct 29 NRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFL 65 > At5g46150 Length=329 Score = 30.8 bits (68), Expect = 0.56, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 0/34 (0%) Query 78 ALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIFV 111 AL F QQ++ A +P+LTP ++ V +G +F+ Sbjct 25 ALYQFKQQKLPACKPVLTPISVITVFMLMGFVFI 58 > At5g11040 Length=1186 Score = 30.0 bits (66), Expect = 0.95, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 27 EEHVKQPDSPDVPESPSQELPRTRISRECSG 57 E K+ DS V +SP E P+TRI R+ S Sbjct 914 ENSAKEDDSSPVQDSPEYEYPKTRIDRDYSA 944 > Hs22063139_1 Length=375 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query 30 VKQPDSPDVPESPSQELPRTRI-SRECSGCSDGVKRSCGCGRCYCCSRA 77 +++PD DV + +++L + S+E S S G KRS GR Y + A Sbjct 57 MEEPDRKDVAQEDAEKLGFSETDSKEASSESSGHKRSSSWGRTYSFTSA 105 > 7293430 Length=503 Score = 30.0 bits (66), Expect = 1.2, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 52 SRECSGCSDGVKRSCGCGRCYCCSRAALDDFMQQRMSAWEP 92 ++EC CS +++ GC C ++ ++F + +WEP Sbjct 288 TKECPRCSVTIEKDGGCNHMVCKNQNCKNEFCWVCLGSWEP 328 > YLR163c Length=462 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 0/41 (0%) Query 7 VAPAAGVVHHDSLCHDGQGYEEHVKQPDSPDVPESPSQELP 47 V AG V H+ L Q Y HV + +SP SP LP Sbjct 209 VLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLP 249 > At1g54320 Length=349 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 76 RAALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIFVVL 113 R F QQ + A +P+LTP ++ V +IF+ L Sbjct 27 RPKYSKFTQQELPACKPILTPGWVISTFLIVSVIFIPL 64 > Hs8922720 Length=361 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 0/19 (0%) Query 82 FMQQRMSAWEPLLTPRRIL 100 F QQR+ AW+P+LT +L Sbjct 33 FKQQRLPAWQPILTAGTVL 51 > CE04378 Length=1592 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 24 QGYEEHVKQPDSPDVPESPSQELPRTR 50 QGY+ D P+VP P Q +P T+ Sbjct 1284 QGYDLQSNAQDDPEVPREPVQHVPITQ 1310 > CE27123 Length=1596 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 24 QGYEEHVKQPDSPDVPESPSQELPRTR 50 QGY+ D P+VP P Q +P T+ Sbjct 1284 QGYDLQSNAQDDPEVPREPVQHVPITQ 1310 > 7294826 Length=511 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Query 52 SRECSGCSDGVKRSCGCGRCYCCSRAALDDFMQQRMSAWEP 92 ++EC C+ +++ GC C + + DF + +WEP Sbjct 293 TKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGSWEP 333 > At3g12740 Length=350 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 76 RAALDDFMQQRMSAWEPLLTPRRILFVLFGVGLIFVVL 113 R F QQ + A +P+LTP ++ + +IF+ L Sbjct 28 RPKYSKFTQQELPACKPILTPGWVISTFLIISVIFIPL 65 > At2g25370 Length=546 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 0/61 (0%) Query 21 HDGQGYEEHVKQPDSPDVPESPSQELPRTRISRECSGCSDGVKRSCGCGRCYCCSRAALD 80 H Y+++ K P V + + L ++ R+C C ++ S GC C A D Sbjct 432 HTDLSYDDYKKLHPDPLVDDLKLKSLANDKMWRQCVKCRHMIELSHGCNHMTCSYDAPRD 491 Query 81 D 81 D Sbjct 492 D 492 > HsM7710141_2 Length=385 Score = 28.5 bits (62), Expect = 3.6, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query 38 VPESPSQELPRTRISRECSGCSDGVKRSCGCGRC-YCCSRAALDDFMQQRM 87 V E Q R +R+C C+ ++R+ GCGRC +CC + Q+R Sbjct 101 VDEDELQPYTNRRQNRKCGACAACLRRN-GCGRCDFCCDKPKFGGSNQKRQ 150 > HsM7710139_2 Length=430 Score = 28.1 bits (61), Expect = 3.9, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query 38 VPESPSQELPRTRISRECSGCSDGVKRSCGCGRC-YCCSRAALDDFMQQRM 87 V E Q R +R+C C+ ++R+ GCGRC +CC + Q+R Sbjct 146 VDEDELQPYTNRRQNRKCGACAACLRRN-GCGRCDFCCDKPKFGGSNQKRQ 195 > At4g16440_2 Length=304 Score = 27.7 bits (60), Expect = 5.2, Method: Compositional matrix adjust. Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 14/88 (15%) Query 30 VKQPDSPDVPESPSQELPRTRIS-RECSGCSDGVKRSCGC---GRCYCCSRAALDDFMQ- 84 VK+ D P V +P Q+L +IS ++C CS GC + +LD+F+ Sbjct 35 VKKSDRPQVVIAPKQQLEPVKISLKDCLACS-------GCITSAETVMLEKQSLDEFLSA 87 Query 85 -QRMSAWE-PLLTPRRILFVLFGVGLIF 110 + W P L R + L+F Sbjct 88 LSKGKTWLCPFLHSRELPLRFTMTSLLF 115 > HsM7710137_2 Length=411 Score = 27.3 bits (59), Expect = 6.4, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Query 50 RISRECSGCSDGVKRSCGCGRC-YCCSRAALDDFMQQRM 87 R +R+C C+ ++R+ GCGRC +CC + Q+R Sbjct 135 RQNRKCGACAACLRRN-GCGRCDFCCDKPKFGGSNQKRQ 172 > CE27737 Length=465 Score = 27.3 bits (59), Expect = 6.9, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 19/41 (46%), Gaps = 0/41 (0%) Query 52 SRECSGCSDGVKRSCGCGRCYCCSRAALDDFMQQRMSAWEP 92 ++EC C +++ GC C + A +F + WEP Sbjct 279 TKECPKCMITIEKDGGCNHMTCKNTACRFEFCWMCLGPWEP 319 > Hs20540861 Length=422 Score = 27.3 bits (59), Expect = 7.7, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query 24 QGYEEHVKQPDSPDVPESPSQELPRTRISRECSGCSDGVKRSCGCGRCYCCSRA 77 +G E+ PDSP PE+ S+ PR I +E + +R+ G Y RA Sbjct 108 KGPEDLGYSPDSPTRPETSSENTPRENIPQE---ADESGQRNRDLGLLYLHYRA 158 > Hs17465835 Length=541 Score = 26.9 bits (58), Expect = 9.7, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 8/57 (14%) Query 2 MRRQKVAPAAGVVHHDSLCHDGQGYEEHVKQPDSPDVPESPSQELPRTRISRECSGC 58 +RR + G+ + S+CH QGYE+ ++P P S SQ +P ++ C GC Sbjct 133 LRRLHLPRGEGINEYLSICHF-QGYEQGPRKP-----PRSESQPVPSKELA--CGGC 181 Lambda K H 0.325 0.139 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1185472426 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40