bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2042_orf1 Length=75 Score E Sequences producing significant alignments: (Bits) Value Hs4504623 36.2 0.017 Hs20470741 32.7 0.16 Hs7662212 32.7 0.18 At1g08840 32.7 0.18 YMR080c 32.3 0.19 CE23725 31.6 0.38 CE02219 31.6 0.38 At2g03270 31.2 0.49 ECU10g1640 30.4 0.74 CE19303 30.0 0.96 7291108 30.0 1.2 YGR248w 29.3 1.9 At4g15570 29.3 1.9 SPAC6G9.10c 28.9 2.2 7303245 27.7 5.6 > Hs4504623 Length=993 Score = 36.2 bits (82), Expect = 0.017, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKRHIDEFA 35 L GDHKQLPPT VS +A+ G ++ +R +E+ Sbjct 397 LAGDHKQLPPTTVSHKAALAGLSLSLMERLAEEYG 431 > Hs20470741 Length=1060 Score = 32.7 bits (73), Expect = 0.16, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKR 29 L+GDH+QLPP +++REA G + KR Sbjct 784 LVGDHQQLPPLVLNREARALGMSESLFKR 812 > Hs7662212 Length=828 Score = 32.7 bits (73), Expect = 0.18, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKR 29 L+GD KQLPPT++S +A + G D + R Sbjct 355 LVGDPKQLPPTVISMKAQEYGYDQSMMAR 383 > At1g08840 Length=1296 Score = 32.7 bits (73), Expect = 0.18, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKR 29 L+GDH QLPP + S EA + G I+ +R Sbjct 1042 LVGDHYQLPPLVQSTEARENGMGISLFRR 1070 > YMR080c Length=971 Score = 32.3 bits (72), Expect = 0.19, Method: Composition-based stats. Identities = 12/21 (57%), Positives = 17/21 (80%), Gaps = 0/21 (0%) Query 1 LIGDHKQLPPTIVSREASDGG 21 L+GDH+QL P I+ R+A+D G Sbjct 595 LVGDHQQLGPVILERKAADAG 615 > CE23725 Length=1069 Score = 31.6 bits (70), Expect = 0.38, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKR 29 L+GD KQL P +VSR+A G+ I++ ++ Sbjct 812 LVGDCKQLTPLVVSRKAKQEGAGISTMEK 840 > CE02219 Length=1105 Score = 31.6 bits (70), Expect = 0.38, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 21/29 (72%), Gaps = 0/29 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKR 29 L+GD KQL P +VSR+A G+ I++ ++ Sbjct 848 LVGDCKQLTPLVVSRKAKQEGAGISTMEK 876 > At2g03270 Length=635 Score = 31.2 bits (69), Expect = 0.49, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKRHIDEFA 35 L GDH QLPPTI S EA G T +R D + Sbjct 387 LAGDHLQLPPTIQSAEAERKGLGRTLFERLADLYG 421 > ECU10g1640 Length=782 Score = 30.4 bits (67), Expect = 0.74, Method: Composition-based stats. Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%) Query 1 LIGDHKQLPPTIVSREASDGG 21 L+GDHKQL PTI+ ++ + G Sbjct 525 LVGDHKQLGPTILCKKVAQAG 545 > CE19303 Length=693 Score = 30.0 bits (66), Expect = 0.96, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKRHIDEFA 35 L+GD KQLP ++S +A G ++ ++ +EF+ Sbjct 431 LVGDQKQLPAVVLSDKAMKGNFKLSLMEKLAEEFS 465 > 7291108 Length=1119 Score = 30.0 bits (66), Expect = 1.2, Method: Compositional matrix adjust. Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKR 29 L+GD +QLPP + S+EA G+D T +R Sbjct 812 LVGDPEQLPPIVRSKEARQRGADETLFQR 840 > YGR248w Length=255 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 0/58 (0%) Query 3 GDHKQLPPTIVSREASDGGSDITSQKRHIDEFAWFLPAIEELLCLSVSLDGQAWRFAP 60 G+ L PT+ + S G T+ ++ +E+A LPA +L+ L DG P Sbjct 103 GNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCGEDGHTCSLFP 160 > At4g15570 Length=525 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%) Query 1 LIGDHKQLPPTIVSREASDGG 21 L+GD KQLP T++S A D G Sbjct 225 LVGDPKQLPATVISTVAQDSG 245 > SPAC6G9.10c Length=1687 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 16/18 (88%), Gaps = 0/18 (0%) Query 1 LIGDHKQLPPTIVSREAS 18 L+GD QLPPT++S++A+ Sbjct 1401 LVGDPNQLPPTVLSKKAA 1418 > 7303245 Length=1194 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 1 LIGDHKQLPPTIVSREASDGGSDITSQKR 29 L GDHKQL P + S+ A++ G +T +R Sbjct 652 LSGDHKQLGPVLQSQRANEWGLGLTLFER 680 Lambda K H 0.320 0.137 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181410888 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40