bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2256_orf3 Length=52 Score E Sequences producing significant alignments: (Bits) Value CE21971 40.0 0.001 YER172c 38.5 0.003 SPAC9.03c 36.2 0.016 Hs22042312 33.1 0.13 At1g20960 33.1 0.14 At2g42270 31.2 0.44 > CE21971 Length=2145 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Query 1 SAAAEFGSLPLRPGEETVLKGIAQRIGLKLPASIDFTKASTKALVLLHAH 50 SA++EFG++P+R E+ +L+ +A+R+ +L FT K +L+HAH Sbjct 1849 SASSEFGNVPMRHKEDVILRQLAERLPGQLKNQ-KFTDPHVKVNLLIHAH 1897 > YER172c Length=2163 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 0/50 (0%) Query 1 SAAAEFGSLPLRPGEETVLKGIAQRIGLKLPASIDFTKASTKALVLLHAH 50 S A EF S+PLR G+ +L +++R+ L+ P S K +LL A+ Sbjct 1884 STAVEFESVPLRKGDRALLVKLSKRLPLRFPEHTSSGSVSFKVFLLLQAY 1933 > SPAC9.03c Length=2176 Score = 36.2 bits (82), Expect = 0.016, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Query 1 SAAAEFGSLPLRPGEETVLKGIAQRIGLKLPASIDFTKASTKALVLLHAH 50 ++AAE+ LP+R E+ VL+ I R+ ++L ++ ++ TK+ +LL AH Sbjct 1886 TSAAEYEQLPIRKYEDIVLERIHSRLPVRL-SNPNYEDPHTKSFILLAAH 1934 > Hs22042312 Length=2136 Score = 33.1 bits (74), Expect = 0.13, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Query 1 SAAAEFGSLPLRPGEETVLKGIAQRIGLKLPASIDFTKASTKALVLLHAH 50 S AAE+ ++P+R E+ +L+ +AQ++ KL + F K +LL AH Sbjct 1850 SNAAEYENIPIRHHEDNLLRQLAQKVPHKL-NNPKFNDPHVKTNLLLQAH 1898 > At1g20960 Length=2171 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 5/52 (9%) Query 1 SAAAEFGSLPLRPGEETVLKGIA--QRIGLKLPASIDFTKASTKALVLLHAH 50 ++A+E+ +P+RPGEE ++ + QR + P D KA LL AH Sbjct 1877 TSASEYDMIPIRPGEEDTVRRLINHQRFSFENPKCTD---PHVKANALLQAH 1925 > At2g42270 Length=2172 Score = 31.2 bits (69), Expect = 0.44, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Query 1 SAAAEFGSLPLRPGEETVLKGIA--QRIGLKLPASIDFTKASTKALVLLHAH 50 ++A+E+ +P+RPGEE ++ + QR + P D K LL AH Sbjct 1878 TSASEYDLIPIRPGEEDAVRRLINHQRFSFQNPRCTD---PRVKTSALLQAH 1926 Lambda K H 0.319 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1158678716 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40