bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2306_orf1 Length=56 Score E Sequences producing significant alignments: (Bits) Value At4g08960 52.0 3e-07 Hs10880987 50.4 7e-07 Hs22046124 50.4 8e-07 7295814 39.3 0.002 YIL153w 36.2 0.014 SPAC4F10.04 33.1 0.14 CE27321 30.4 0.78 Hs22062496 30.0 0.96 > At4g08960 Length=401 Score = 52.0 bits (123), Expect = 3e-07, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%) Query 20 ALIEVLQRLLQWVDEIPPIEQPTRFGNQAFKTWCRRL 56 A++ +L+ LLQW+DEIPP +Q R+GN +F++W RL Sbjct 149 AIVSILETLLQWIDEIPPAQQSARYGNVSFRSWHERL 185 > Hs10880987 Length=323 Score = 50.4 bits (119), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 19/42 (45%), Positives = 32/42 (76%), Gaps = 0/42 (0%) Query 15 NKACWALIEVLQRLLQWVDEIPPIEQPTRFGNQAFKTWCRRL 56 ++A L+ +L L +W+DE PP++QP+RFGN+A++TW +L Sbjct 71 SEAIEKLLALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKL 112 > Hs22046124 Length=408 Score = 50.4 bits (119), Expect = 8e-07, Method: Composition-based stats. Identities = 19/42 (45%), Positives = 32/42 (76%), Gaps = 0/42 (0%) Query 15 NKACWALIEVLQRLLQWVDEIPPIEQPTRFGNQAFKTWCRRL 56 ++A L+ +L L +W+DE PP++QP+RFGN+A++TW +L Sbjct 156 SEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKL 197 > 7295814 Length=398 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 0/36 (0%) Query 21 LIEVLQRLLQWVDEIPPIEQPTRFGNQAFKTWCRRL 56 L+ + L + V++ PP+EQP RFGN+A++ W + + Sbjct 66 LLRLFDALEKLVEQNPPLEQPQRFGNKAYRDWAQAM 101 > YIL153w Length=393 Score = 36.2 bits (82), Expect = 0.014, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 20 ALIEVLQRLLQWVDEIPPIEQPTRFGNQAFKTWCRRL 56 L+ VL +L +DE PP+ P R+GN A + W +L Sbjct 69 GLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKL 105 > SPAC4F10.04 Length=325 Score = 33.1 bits (74), Expect = 0.14, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 0/36 (0%) Query 21 LIEVLQRLLQWVDEIPPIEQPTRFGNQAFKTWCRRL 56 L+ +L R+ + +PP RFGN AF+ W +L Sbjct 76 LVRILCRVKEITKTVPPASGRHRFGNPAFRIWHEKL 111 > CE27321 Length=375 Score = 30.4 bits (67), Expect = 0.78, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Query 20 ALIEVLQRLLQWVDEIPPIE-QPTRFGNQAFKTWCRRL 56 + I++L +L +W +EIP + RFGN+A++ + +L Sbjct 59 SFIDMLDKLEKWAEEIPLEDVSEQRFGNKAYRKFYEKL 96 > Hs22062496 Length=1523 Score = 30.0 bits (66), Expect = 0.96, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 1 SYPTVAEDKQQLPANKACWALIEVLQRLLQWVDEI 35 S P AE+ ++LP ++A AL+ Q LL+W E+ Sbjct 1016 SSPEKAEEDRRLPGSQAPPALVSSSQSLLEWCQEV 1050 Lambda K H 0.322 0.135 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40