bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2440_orf2 Length=135 Score E Sequences producing significant alignments: (Bits) Value 7299840 30.8 0.79 7298579 30.4 1.1 CE23663 30.0 1.4 Hs7657015 30.0 1.4 Hs22041491 28.5 3.7 Hs7657118 27.7 5.8 > 7299840 Length=632 Score = 30.8 bits (68), Expect = 0.79, Method: Composition-based stats. Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Query 9 GWGLIPLPVPRGVGSKGVAPIEILSLMESQEKLFFSMPWMAVTGFSYCERLSFQELCMAI 68 G+G P P+ R G K + ++ +S + +P + YC RL+ E A+ Sbjct 483 GYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLT-SEGFEAL 541 Query 69 TQKLLKPKQEFACLANCTGGSD 90 TQ P E C+++C D Sbjct 542 TQNC--PSLEALCVSSCMAVDD 561 > 7298579 Length=506 Score = 30.4 bits (67), Expect = 1.1, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query 17 VPRGVGSKGVAPIEILSLMESQEKLFFSMPWMAVTGFSYCE 57 +P GVGSKG+ P+ L E+ E M W G+ + E Sbjct 152 IPVGVGSKGIIPMNARDLEEALE---MGMDWSLREGYVWAE 189 > CE23663 Length=505 Score = 30.0 bits (66), Expect = 1.4, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query 17 VPRGVGSKGVAPIEILSLMESQEKLFFSMPWMAVTGFSYCE 57 +P GVGS+G P+ L+E E M W G+S+ E Sbjct 151 IPVGVGSRGAIPMLASDLVECLE---MGMDWTLREGYSWAE 188 > Hs7657015 Length=505 Score = 30.0 bits (66), Expect = 1.4, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query 17 VPRGVGSKGVAPIEILSLMESQEKLFFSMPWMAVTGFSYCE 57 +P GVGSKGV P+ L E+ E + W G+++ E Sbjct 151 IPVGVGSKGVIPMNAKDLEEALE---MGVDWSLREGYAWAE 188 > Hs22041491 Length=100 Score = 28.5 bits (62), Expect = 3.7, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 0/50 (0%) Query 83 ANCTGGSDFLDQLPVSAFLHPRLLARVQRVMGRYCWVRQPGFKVSQQVIK 132 NC+ SDF + HP V + R+ + PG KV QQ ++ Sbjct 17 TNCSDSSDFFLRPIAECLNHPASRVGVTGHLSRFYKLHSPGAKVKQQQLE 66 > Hs7657118 Length=419 Score = 27.7 bits (60), Expect = 5.8, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 0/31 (0%) Query 73 LKPKQEFACLANCTGGSDFLDQLPVSAFLHP 103 + P QE CLA+ G F+D+ + FL P Sbjct 211 IAPLQEICCLASRYGALVFMDECHATGFLGP 241 Lambda K H 0.326 0.138 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1388795348 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40