bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2651_orf1 Length=97 Score E Sequences producing significant alignments: (Bits) Value Hs5453617 37.7 0.005 At1g17110 35.4 0.025 At5g65450 34.3 0.056 7290089 32.0 0.30 CE16955 31.6 0.37 At4g31670 30.8 0.67 7296927 30.0 1.1 CE18125 29.3 1.9 At1g70010 28.5 3.1 At4g24560 28.1 3.8 7293134 28.1 3.8 Hs22060813_2 27.3 7.1 CE16224 26.9 8.4 At2g44410 26.9 9.4 > Hs5453617 Length=154 Score = 37.7 bits (86), Expect = 0.005, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 6/68 (8%) Query 30 RERRNLGGWLQSRRSIPLELTVPGPSYMAMAAPPPLHLGGYHLCSVCLLPASYKCVRCRG 89 R R+N L+ + E GP+Y+ A PP C+VC P+ Y CV C G Sbjct 79 RFRKNFQALLEEQNLSVAE----GPNYLTACAGPPSR-PQRPFCAVCGFPSPYTCVSC-G 132 Query 90 ALFCSIKC 97 A +C+++C Sbjct 133 ARYCTVRC 140 > At1g17110 Length=891 Score = 35.4 bits (80), Expect = 0.025, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 64 PLHLGGYHLCSVCLLPASYKCVRCRGALFCSIKC 97 P++ H+C+ C PA +C RC+ +CS KC Sbjct 121 PVNNNELHVCARCFGPAKTRCSRCKSVRYCSGKC 154 > At5g65450 Length=731 Score = 34.3 bits (77), Expect = 0.056, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Query 55 SYMAMAA-PPPLHLGG-----YHLCSVCLLPASYKCVRCRGALFCSIKC 97 SY+A P + GG + C+VCL P + +C +C+ +CS KC Sbjct 33 SYLAEEVRPATVDYGGDSVSDVYRCAVCLYPTTTRCSQCKSVRYCSSKC 81 > 7290089 Length=1376 Score = 32.0 bits (71), Expect = 0.30, Method: Compositional matrix adjust. Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 0/67 (0%) Query 10 GGVHVNKISVNVVQTVSDVGRERRNLGGWLQSRRSIPLELTVPGPSYMAMAAPPPLHLGG 69 G +++ V V+ VSD E R Q+R ++ + GP+Y+ ++ P Sbjct 798 GQINMRDARVEEVEHVSDSDSEEREDAAQDQARLTVAIYPAHQGPTYLILSGKPERDNWL 857 Query 70 YHLCSVC 76 YHL V Sbjct 858 YHLTVVS 864 > CE16955 Length=263 Score = 31.6 bits (70), Expect = 0.37, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query 59 MAAPPPLHLGGYHLCSVCLLPASYKCVRCRGALFCSIKC 97 +++ PP C+VC + + Y C RC GA +CS+ C Sbjct 212 LSSAPPSEKPARKFCAVCGIISKYCCTRC-GAKYCSLPC 249 > At4g31670 Length=631 Score = 30.8 bits (68), Expect = 0.67, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 73 CSVCLLPASYKCVRCRGALFCSIKC 97 CSVC ++ KC RC+ +CS +C Sbjct 61 CSVCGNFSTKKCSRCKSVRYCSAEC 85 > 7296927 Length=151 Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query 54 PSYMAMAAPPPLHLGGYHLCSVCLLPASYKCVRCRGALFCSIKC 97 P+Y + AAP P H C+VC + Y C C G +C ++C Sbjct 96 PNYESAAAPAP-QKPLRHFCAVCGNFSLYSCTAC-GTRYCCVRC 137 > CE18125 Length=386 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 0/34 (0%) Query 61 APPPLHLGGYHLCSVCLLPASYKCVRCRGALFCS 94 A P G LC +C A+ KC +C+ A +CS Sbjct 134 ADPRAPADGPGLCRICGCSAAKKCAKCQVARYCS 167 > At1g70010 Length=1315 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 0/22 (0%) Query 67 LGGYHLCSVCLLPASYKCVRCR 88 L G H VC LPA +C+ CR Sbjct 824 LEGTHTWEVCSLPADKRCIGCR 845 > At4g24560 Length=1008 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 73 CSVCLLPASYKCVRCRGALFCSIKC 97 C VC A+ +C RC+ +CS KC Sbjct 74 CPVCYCLATTRCSRCKAVRYCSGKC 98 > 7293134 Length=308 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 73 CSVCLLPASYKCVRCRGALFCSI 95 C++C A ++C C G LFC++ Sbjct 255 CNICNEDADFRCHGCGGELFCTL 277 > Hs22060813_2 Length=141 Score = 27.3 bits (59), Expect = 7.1, Method: Compositional matrix adjust. Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 0/27 (0%) Query 68 GGYHLCSVCLLPASYKCVRCRGALFCS 94 G HLCSVC C RC A +CS Sbjct 72 SGAHLCSVCGCLGPKTCSRCHKAYYCS 98 > CE16224 Length=1806 Score = 26.9 bits (58), Expect = 8.4, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Query 69 GYHLCSVCLLPASYKCVRCRGALFCSIKC 97 GY CS C+ + Y C C G CS C Sbjct 620 GYGTCSSCM-SSEYNCAWCSGLHKCSNSC 647 > At2g44410 Length=404 Score = 26.9 bits (58), Expect = 9.4, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 0/26 (0%) Query 68 GGYHLCSVCLLPASYKCVRCRGALFC 93 GG+ C++CL A + C G LFC Sbjct 111 GGFFDCNICLEKAEDPILTCCGHLFC 136 Lambda K H 0.323 0.139 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1198045380 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40