bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_2881_orf2 Length=62 Score E Sequences producing significant alignments: (Bits) Value At3g16090 37.7 0.005 Hs22062486 32.3 0.21 7302095 31.2 0.50 SPBC17D11.02c 30.4 0.75 SPCC4B3.04c 29.6 1.3 At1g08800 29.6 1.4 > At3g16090 Length=492 Score = 37.7 bits (86), Expect = 0.005, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 7 EFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQV 56 +FY A V L+++K++L + N CL++ L + + +G LR EVE++ Sbjct 28 QFYPATVYLSTSKISLVLLLNMCLVLMLSLWHLVKFVFLGSLREAEVERL 77 > Hs22062486 Length=617 Score = 32.3 bits (72), Expect = 0.21, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 0/57 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLD 58 Y +FY VV L + ++A+ Y ++ L K + + G+LR E+E +L+ Sbjct 23 YYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLE 79 > 7302095 Length=621 Score = 31.2 bits (69), Expect = 0.50, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 0/57 (0%) Query 2 YLFNDEFYTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVEQVLD 58 Y +FY AVV + + ++ + Y ++ +F K + + +G LR E E +L+ Sbjct 12 YYQKQQFYPAVVYITKSNASMGVIYIQFFVIVFMFGKLLSKIFLGTLRAAEFEHLLE 68 > SPBC17D11.02c Length=677 Score = 30.4 bits (67), Expect = 0.75, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%) Query 9 YTAVVKLASNKLALAIEYNFCLLMFLLFVKFILHLLVGRLRRLEVE 54 Y+A V ++ + + + I N CL +F + LL G L+ E+E Sbjct 29 YSATVMISQSPVHITIGLNVCLCLFFAIANALKTLLFGSLQTFELE 74 > SPCC4B3.04c Length=1316 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Query 3 LFNDEFYTAVVKLASNKL---ALAIEYNFCLLMFLLFVKFILHLLVGRLRRL 51 LF F T V + K+ +L I++NF L+FL FV + +LV R R L Sbjct 36 LFLLSFATITVPKWAYKIVTYSLTIQFNFKSLLFLFFVSICVVILVVRYRYL 87 > At1g08800 Length=1110 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 21 ALAIEYNFCLLMFLLFVKFILHLLVGRL 48 ALA+ +N LLMF+LFV I ++ R Sbjct 9 ALALAFNEWLLMFMLFVNSIFSYVIARF 36 Lambda K H 0.335 0.151 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175803722 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40