bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0043_orf1 Length=145 Score E Sequences producing significant alignments: (Bits) Value xla:399086 tbpl1, MGC84998, tlf; TBP-like 1; K03120 transcript... 118 5e-27 mmu:237336 Tbpl1, 4732475G08, AW011832, AW491032, D18347, STD,... 118 5e-27 hsa:9519 TBPL1, MGC:8389, MGC:9620, STUD, TLF, TLP, TRF2; TBP-... 118 5e-27 dre:403035 tbpl1, MGC92340, tlf, tlp, trf, trf2, trp, zgc:9234... 117 1e-26 cel:F39H11.2 tlf-1; TBP-Like Factor family member (tlf-1); K03... 76.6 2e-14 ath:AT1G55520 TBP2; TBP2 (TATA BINDING PROTEIN 2); DNA binding... 75.5 5e-14 sce:YER148W SPT15, BTF1, TBP1; Spt15p; K03120 transcription in... 73.9 2e-13 cel:T20B12.2 tbp-1; TATA-Binding Protein family member (tbp-1)... 72.4 4e-13 dre:368882 tbp, fd20h06, si:zc101n13.2, wu:fd20h06, zgc:66213;... 70.9 1e-12 xla:399465 tbp-a, MGC132200, TBP, gtf2d, gtf2d1, sca17, tfiid,... 70.9 1e-12 mmu:21374 Tbp, GTF2D1, Gtf2d, SCA17, TFIID; TATA box binding p... 70.9 1e-12 xla:503680 tbp-b, gtf2d, gtf2d1, sca17, tbp, tfiid, xtbp; TATA... 70.5 2e-12 dre:407713 tbpl2, tbp2, trf3; TATA box binding protein like 2;... 70.5 2e-12 hsa:6908 TBP, GTF2D, GTF2D1, HDL4, MGC117320, MGC126054, MGC12... 70.5 2e-12 xla:387333 tbpl2, tbp2, trf3; TATA box binding protein like 2;... 68.9 5e-12 hsa:387332 TBPL2, TBP2, TRF3; TATA box binding protein like 2;... 67.4 2e-11 mmu:227606 Tbpl2, Gm348, Trf3; TATA box binding protein like 2... 67.0 2e-11 ath:AT3G13445 TBP1; TBP1 (TATA BINDING PROTEIN 1); DNA binding... 62.8 3e-10 tpv:TP01_0630 transcription initiation factor TFIID; K03120 tr... 59.3 4e-09 cpv:cgd8_2030 TATA-box factor binding protein ; K03120 transcr... 56.6 2e-08 pfa:PFE0305w transcription initiation factor TFiid, TATA-bindi... 56.6 3e-08 tgo:TGME49_058680 TATA-box binding protein, putative ; K03120 ... 49.3 4e-06 bbo:BBOV_IV002970 21.m02732; TATA-box binding protein; K03120 ... 46.2 4e-05 dre:368917 adam8a, MGC64059, adam8, reprolysin, si:zc217g15.7,... 31.6 0.80 dre:565984 similar to Protein-glutamine gamma-glutamyltransfer... 31.2 1.2 mmu:17281 Fyco1, 2810409M01Rik, Mem2, RUFY3, ZFYVE7; FYVE and ... 30.8 1.4 hsa:57505 AARS2, AARSL, KIAA1270, MT-ALARS, MTALARS, bA444E17.... 30.4 1.8 tgo:TGME49_091080 TATA-box binding protein, putative 29.3 4.0 mmu:224805 Aars2, Aarsl, AlaRS, Gm89, MGC69820; alanyl-tRNA sy... 29.3 4.3 tgo:TGME49_059860 hypothetical protein 28.5 8.0 bbo:BBOV_II002380 18.m06194; hypothetical protein 28.1 9.8 > xla:399086 tbpl1, MGC84998, tlf; TBP-like 1; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=186 Score = 118 bits (296), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 53/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF+VKF +++VVNVL C +PF I++ EF+ ++R ASYE ELHP YRIK L+A L+ Sbjct 91 LGFQVKFTEFKVVNVLAVCTMPFEIRLNEFTKQNRPHASYEPELHPAVCYRIKSLRATLQ 150 Query 61 IFQTGSITITAPSIQNVQLAVEQIYPLVYEFRK 93 IF TGSIT+T P +++V A+EQIYP V+E RK Sbjct 151 IFSTGSITVTGPDVKSVASAIEQIYPFVFESRK 183 > mmu:237336 Tbpl1, 4732475G08, AW011832, AW491032, D18347, STD, TLF, TRF2, TRP, Tlp; TATA box binding protein-like 1; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=186 Score = 118 bits (296), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF+V F ++VVNVL C +PF I++PEF+ +R ASYE ELHP YRIK L+A L+ Sbjct 91 LGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQ 150 Query 61 IFQTGSITITAPSIQNVQLAVEQIYPLVYEFRK 93 IF TGSIT+T P+++ V AVEQIYP V+E RK Sbjct 151 IFSTGSITVTGPNVKAVATAVEQIYPFVFESRK 183 > hsa:9519 TBPL1, MGC:8389, MGC:9620, STUD, TLF, TLP, TRF2; TBP-like 1; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=186 Score = 118 bits (296), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF+V F ++VVNVL C +PF I++PEF+ +R ASYE ELHP YRIK L+A L+ Sbjct 91 LGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQ 150 Query 61 IFQTGSITITAPSIQNVQLAVEQIYPLVYEFRK 93 IF TGSIT+T P+++ V AVEQIYP V+E RK Sbjct 151 IFSTGSITVTGPNVKAVATAVEQIYPFVFESRK 183 > dre:403035 tbpl1, MGC92340, tlf, tlp, trf, trf2, trp, zgc:92340; TBP-like 1; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=186 Score = 117 bits (293), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 49/93 (52%), Positives = 74/93 (79%), Gaps = 0/93 (0%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 +GF+V+F ++VVNVL C +PF I++ EF+ +R +ASYE ELHP A+YRIK L++ ++ Sbjct 91 MGFKVRFSDFKVVNVLAVCSMPFQIRLIEFTKNNRPIASYEPELHPAASYRIKNLRSTVQ 150 Query 61 IFQTGSITITAPSIQNVQLAVEQIYPLVYEFRK 93 +F TG+IT+T P++Q+V AVE+IYPL++E RK Sbjct 151 VFSTGNITVTGPNVQSVASAVEEIYPLLFECRK 183 > cel:F39H11.2 tlf-1; TBP-Like Factor family member (tlf-1); K03120 transcription initiation factor TFIID TATA-box-binding protein Length=505 Score = 76.6 bits (187), Expect = 2e-14, Method: Composition-based stats. Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%) Query 4 RVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLKIFQ 63 RV YRV NVL CRLPFGIK+ E + ++ ++YE EL G +R KA L+I Sbjct 352 RVSIRNYRVNNVLATCRLPFGIKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHT 411 Query 64 TGSITIT-APSIQNVQLAVEQIYPLVYEFR 92 TGSIT+T A S +V + +IYP+V EFR Sbjct 412 TGSITVTGAQSEADVLEVLSKIYPIVLEFR 441 > ath:AT1G55520 TBP2; TBP2 (TATA BINDING PROTEIN 2); DNA binding / RNA polymerase II transcription factor/ TATA-binding protein binding; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=200 Score = 75.5 bits (184), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 39/94 (41%), Positives = 56/94 (59%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ + H +SYE EL PG YR+K K VL Sbjct 104 LGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMKLPKIVLL 163 Query 61 IFQTGSITITAPSI-QNVQLAVEQIYPLVYEFRK 93 IF +G I IT + + A E IYP++ EFRK Sbjct 164 IFVSGKIVITGAKMREETYTAFENIYPVLREFRK 197 > sce:YER148W SPT15, BTF1, TBP1; Spt15p; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=240 Score = 73.9 bits (180), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 +GF KF +++ N++G+C + F I++ + H +SYE EL PG YR+ + K VL Sbjct 146 IGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLL 205 Query 61 IFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 IF +G I +T A + + A E IYP++ EFRK Sbjct 206 IFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRK 239 > cel:T20B12.2 tbp-1; TATA-Binding Protein family member (tbp-1); K03120 transcription initiation factor TFIID TATA-box-binding protein Length=340 Score = 72.4 bits (176), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 35/94 (37%), Positives = 59/94 (62%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF+ KF ++ V N++G+C + F I++ H + ++YE EL PG YR+ + + VL Sbjct 247 LGFQAKFTEFMVQNMVGSCDVRFPIQLEGLCITHSQFSTYEPELFPGLIYRMVKPRVVLL 306 Query 61 IFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 IF +G + IT A + +++ A QIYP++ F+K Sbjct 307 IFVSGKVVITGAKTKRDIDEAFGQIYPILKGFKK 340 > dre:368882 tbp, fd20h06, si:zc101n13.2, wu:fd20h06, zgc:66213; TATA box binding protein; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=302 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 57/94 (60%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 207 LGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLL 266 Query 61 IFQTGSITITAPSIQ-NVQLAVEQIYPLVYEFRK 93 IF +G + +T ++ + A E IYP++ FRK Sbjct 267 IFVSGKVVLTGAKVRGEIYEAFENIYPILKGFRK 300 > xla:399465 tbp-a, MGC132200, TBP, gtf2d, gtf2d1, sca17, tfiid, tfiidtau, xtbp; TATA box binding protein; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=297 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 57/94 (60%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 202 LGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLL 261 Query 61 IFQTGSITITAPSIQ-NVQLAVEQIYPLVYEFRK 93 IF +G + +T ++ + A E IYP++ FRK Sbjct 262 IFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 295 > mmu:21374 Tbp, GTF2D1, Gtf2d, SCA17, TFIID; TATA box binding protein; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=316 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 57/94 (60%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 221 LGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLL 280 Query 61 IFQTGSITITAPSIQ-NVQLAVEQIYPLVYEFRK 93 IF +G + +T ++ + A E IYP++ FRK Sbjct 281 IFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 314 > xla:503680 tbp-b, gtf2d, gtf2d1, sca17, tbp, tfiid, xtbp; TATA box binding protein; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=296 Score = 70.5 bits (171), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 57/94 (60%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 201 LGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLL 260 Query 61 IFQTGSITITAPSIQ-NVQLAVEQIYPLVYEFRK 93 IF +G + +T ++ + A E IYP++ FRK Sbjct 261 IFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 294 > dre:407713 tbpl2, tbp2, trf3; TATA box binding protein like 2; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=312 Score = 70.5 bits (171), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 35/94 (37%), Positives = 56/94 (59%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 218 LGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLL 277 Query 61 IFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 IF +G + +T A + A E IYP++ FRK Sbjct 278 IFVSGKVVLTGAKERSEIYEAFENIYPILKGFRK 311 > hsa:6908 TBP, GTF2D, GTF2D1, HDL4, MGC117320, MGC126054, MGC126055, SCA17, TFIID; TATA box binding protein; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=319 Score = 70.5 bits (171), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 57/94 (60%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 224 LGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLL 283 Query 61 IFQTGSITITAPSIQ-NVQLAVEQIYPLVYEFRK 93 IF +G + +T ++ + A E IYP++ FRK Sbjct 284 IFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 317 > xla:387333 tbpl2, tbp2, trf3; TATA box binding protein like 2; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=320 Score = 68.9 bits (167), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 56/94 (59%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 225 LGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLL 284 Query 61 IFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 IF +G + +T A + A E IYP++ F+K Sbjct 285 IFVSGKVVLTGAKERSEIYEAFENIYPILKGFKK 318 > hsa:387332 TBPL2, TBP2, TRF3; TATA box binding protein like 2; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=375 Score = 67.4 bits (163), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 33/94 (35%), Positives = 56/94 (59%), Gaps = 1/94 (1%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF +F +++ N++G+C + F I++ H++ +SYE EL PG YR+ + + VL Sbjct 281 LGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLL 340 Query 61 IFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 IF +G + +T A + A E IYP++ F+K Sbjct 341 IFVSGKVVLTGAKERSEIYEAFENIYPILKGFKK 374 > mmu:227606 Tbpl2, Gm348, Trf3; TATA box binding protein like 2; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=350 Score = 67.0 bits (162), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 33/95 (34%), Positives = 58/95 (61%), Gaps = 2/95 (2%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKL-ASYELELHPGATYRIKELKAVL 59 LGF V+F +++ N++G+C + F I++ + HR+ +SYE EL PG Y++ + + VL Sbjct 255 LGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSSYEPELFPGLIYKMVKPQVVL 314 Query 60 KIFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 IF +G + +T A + A E +YP++ F+K Sbjct 315 LIFASGKVVLTGAKERSEIYEAFENMYPILESFKK 349 > ath:AT3G13445 TBP1; TBP1 (TATA BINDING PROTEIN 1); DNA binding / RNA polymerase II transcription factor/ binding; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=196 Score = 62.8 bits (151), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 0/74 (0%) Query 1 LGFRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLK 60 LGF KF +++ N++G+C + F I++ + H +SYE EL PG YR+K K VL Sbjct 104 LGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLL 163 Query 61 IFQTGSITITAPSI 74 IF +G I IT + Sbjct 164 IFVSGKIVITGAKV 177 > tpv:TP01_0630 transcription initiation factor TFIID; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=222 Score = 59.3 bits (142), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 32/97 (32%), Positives = 58/97 (59%), Gaps = 8/97 (8%) Query 2 GFRVKFCQYRVVNVLG--ACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIK---ELK 56 G +KF +++ N++ +C +P ++V FS EH+ L +YE E G YR + E + Sbjct 127 GLDLKFNNFKIENIIATFSCNVPIRLEV--FSQEHKDLCNYEPEFFAGLVYRCRINEESE 184 Query 57 AVLKIFQTGSITIT-APSIQNVQLAVEQIYPLVYEFR 92 AVL IF +G++ IT S Q +Q + +YP++++++ Sbjct 185 AVLLIFVSGNVIITGCKSAQEIQYVFKTMYPILHQYQ 221 > cpv:cgd8_2030 TATA-box factor binding protein ; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=249 Score = 56.6 bits (135), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 31/98 (31%), Positives = 53/98 (54%), Gaps = 6/98 (6%) Query 2 GF-RVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIK----ELK 56 GF +VKF +++ N++ F I++ + +HR +YE EL PG YR K Sbjct 152 GFPKVKFTNFKMENIIATADCKFPIRLEGLAYDHRDFCNYEPELFPGLVYRYHPDNSPTK 211 Query 57 AVLKIFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 AVL +F +G + +T + Q + + IYP++ ++RK Sbjct 212 AVLLLFVSGKVIVTGCKNYQEICNVFDNIYPVLCQYRK 249 > pfa:PFE0305w transcription initiation factor TFiid, TATA-binding protein; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=327 Score = 56.6 bits (135), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 27/93 (29%), Positives = 52/93 (55%), Gaps = 4/93 (4%) Query 4 RVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIK---ELKAVLK 60 +VKFC +++ N++ + I++ + +H++ +YE EL G YR K LK+V+ Sbjct 234 KVKFCNFKIENIIASANCNIPIRLEVLAHDHKEYCNYEPELFAGLVYRYKPTSNLKSVIL 293 Query 61 IFQTGSITIT-APSIQNVQLAVEQIYPLVYEFR 92 IF +G I IT S+ + + IY ++ +++ Sbjct 294 IFVSGKIIITGCKSVNKLYTVFQDIYNVLIQYK 326 > tgo:TGME49_058680 TATA-box binding protein, putative ; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=549 Score = 49.3 bits (116), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 6/94 (6%) Query 6 KFC--QYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYR---IKELKAVLK 60 K C +++ NV+ + +++ + EH++ +SYE EL G YR LKAVL Sbjct 456 KLCLRDFKIENVVASADCGVPVRLEGLAFEHKEFSSYEPELFSGLVYRYNPTASLKAVLL 515 Query 61 IFQTGSITIT-APSIQNVQLAVEQIYPLVYEFRK 93 +F +G + IT S+ V E +YP++ + + Sbjct 516 VFVSGKVVITGCKSLSEVNHVFESLYPVLVRYHQ 549 > bbo:BBOV_IV002970 21.m02732; TATA-box binding protein; K03120 transcription initiation factor TFIID TATA-box-binding protein Length=277 Score = 46.2 bits (108), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 27/98 (27%), Positives = 55/98 (56%), Gaps = 8/98 (8%) Query 1 LGFRVKFCQYRVVNVLGA--CRLPFGIKVPEFSTEHRKLASYELELHPGATYRIK---EL 55 LG ++F +++ N++ C +P I++ EH+ +YE E+ G YRI + Sbjct 181 LGGGIQFNDFKIENIIATFNCNVP--IRLERLYEEHKLFCNYEPEIFAGLVYRIAIPCKS 238 Query 56 KAVLKIFQTGSITIT-APSIQNVQLAVEQIYPLVYEFR 92 +AVL +F +G++ +T S +++ L ++ P++ EF+ Sbjct 239 EAVLLVFVSGNVIVTGCRSPEDIYLIYRRMAPILCEFK 276 > dre:368917 adam8a, MGC64059, adam8, reprolysin, si:zc217g15.7, zgc:64059; a disintegrin and metalloproteinase domain 8a; K06540 disintegrin and metalloproteinase domain-containing protein 8 [EC:3.4.24.-] Length=843 Score = 31.6 bits (70), Expect = 0.80, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 88 VYEFRKPRPQLAINSSTSAAAASSAAGGGNNSP 120 + EFRK RPQ I+SS+ + G NSP Sbjct 681 ITEFRKKRPQKGIHSSSGQCNPAFQPGSAKNSP 713 > dre:565984 similar to Protein-glutamine gamma-glutamyltransferase 5 (Transglutaminase-5) (TGase 5) (Transglutaminase X) (TGase X) (TGX) (TG(X)) Length=724 Score = 31.2 bits (69), Expect = 1.2, Method: Compositional matrix adjust. Identities = 17/69 (24%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Query 5 VKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELH-PGATYRIKELKAVLKIFQ 63 + F +Y++ VL + + V + ++ R LAS E +H P + +I+ ++ Q Sbjct 583 ISFNEYKLKQVLEDYLVNLAVVVEDVKSQERVLASEEFNIHSPALSIQIQNENVIVNSPQ 642 Query 64 TGSITITAP 72 +T T P Sbjct 643 VAMVTFTNP 651 > mmu:17281 Fyco1, 2810409M01Rik, Mem2, RUFY3, ZFYVE7; FYVE and coiled-coil domain containing 1 Length=1438 Score = 30.8 bits (68), Expect = 1.4, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 4/57 (7%) Query 9 QYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRIK----ELKAVLKI 61 Q +++ VL A + G+ +P+ +T+ L+ +LE+H G R++ +L+A L++ Sbjct 704 QIQLIEVLSAEKGQQGLSLPQVNTDQLALSQAQLEIHQGEAQRLQNEVVDLQAKLQV 760 > hsa:57505 AARS2, AARSL, KIAA1270, MT-ALARS, MTALARS, bA444E17.1; alanyl-tRNA synthetase 2, mitochondrial (putative) (EC:6.1.1.7); K01872 alanyl-tRNA synthetase [EC:6.1.1.7] Length=985 Score = 30.4 bits (67), Expect = 1.8, Method: Composition-based stats. Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Query 72 PSIQNVQLAVEQIYPLVYEFRKPRPQLAINSSTSAAAASSAAGGGNNSPEGVGDDLT--- 128 PS+ V + Q P+ PR ++A + + AGG +N E VG DL+ Sbjct 70 PSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGHHNDLEDVGRDLSHHT 129 Query 129 -IDELRNYSDGGD 140 + L N++ GG+ Sbjct 130 FFEMLGNWAFGGE 142 > tgo:TGME49_091080 TATA-box binding protein, putative Length=288 Score = 29.3 bits (64), Expect = 4.0, Method: Compositional matrix adjust. Identities = 25/128 (19%), Positives = 49/128 (38%), Gaps = 40/128 (31%) Query 3 FRVKFCQYRVVNVLGACRLPFGIKVPEFSTEHRKLASYELELHPGATYRI---------- 52 ++V ++RV N+LG+ I + + YE E PGA +I Sbjct 153 YKVSMTRFRVSNILGSYTFSSPISLHALAALRELHVDYEPERFPGARVKITIPKAIDTNS 212 Query 53 -----------------------------KELKAVLKIFQTGSITIT-APSIQNVQLAVE 82 KE L++F TG++T+T S+++++ A++ Sbjct 213 DANETEKAATGGAWASQTGSSQTAQDSKGKEEVVTLQLFSTGNVTLTGGRSVESMEYALQ 272 Query 83 QIYPLVYE 90 + P + + Sbjct 273 CVLPFLQQ 280 > mmu:224805 Aars2, Aarsl, AlaRS, Gm89, MGC69820; alanyl-tRNA synthetase 2, mitochondrial (putative) (EC:6.1.1.7); K01872 alanyl-tRNA synthetase [EC:6.1.1.7] Length=980 Score = 29.3 bits (64), Expect = 4.3, Method: Composition-based stats. Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Query 72 PSIQNVQLAVEQIYPLVYEFRKPRPQLAINSSTSAAAASSAAGGGNNSPEGVGDDLT--- 128 PS+ V + Q P+ PR ++A + AGG +N E VG DL+ Sbjct 65 PSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVVNSQKCVRAGGRHNDLEDVGRDLSHHT 124 Query 129 -IDELRNYSDGGD 140 + L N++ GG+ Sbjct 125 FFEMLGNWAFGGE 137 > tgo:TGME49_059860 hypothetical protein Length=2085 Score = 28.5 bits (62), Expect = 8.0, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 7/44 (15%) Query 90 EFRK-------PRPQLAINSSTSAAAASSAAGGGNNSPEGVGDD 126 EFR+ P P L N+STSAA + AG +PE GD+ Sbjct 783 EFRRDGNPCSPPSPPLGENASTSAAVGTEYAGLATATPESGGDE 826 > bbo:BBOV_II002380 18.m06194; hypothetical protein Length=371 Score = 28.1 bits (61), Expect = 9.8, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Query 23 FGIKVPEFSTEHRKLASYELELHPGATYRIKELKAVLKIFQTG 65 F I V ST+H YE HPG I++ K V +I G Sbjct 256 FNIPV---STDHTSPLIYETVYHPGTVPLIQDFKIVFRITNVG 295 Lambda K H 0.316 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2807590228 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40