bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0305_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_058980 cell differentiation protein Rcd1, putative ... 108 3e-24 pfa:PFE0375w cell differentiation protein rcd1, putative; K126... 101 5e-22 cpv:cgd8_4460 cell differentiation protein rcd1 ; K12606 CCR4-... 90.9 8e-19 hsa:9125 RQCD1, CNOT9, CT129, RCD1, RCD1+; RCD1 required for c... 89.7 2e-18 mmu:58184 Rqcd1, 2610007F23Rik, AI593551, Fl10; rcd1 (required... 89.7 2e-18 ath:AT3G20800 rcd1-like cell differentiation protein, putative... 89.0 3e-18 xla:432229 rqcd1, MGC78923, rcd1; RCD1 required for cell diffe... 88.6 4e-18 tpv:TP02_0463 hypothetical protein; K12606 CCR4-NOT transcript... 86.7 2e-17 ath:AT5G12980 rcd1-like cell differentiation protein, putative... 85.9 3e-17 dre:406632 rqcd1, wu:fb52b11, wu:fb74e08, zgc:85618; RCD1 requ... 82.8 3e-16 cel:C26E6.3 hypothetical protein; K12606 CCR4-NOT transcriptio... 80.9 9e-16 bbo:BBOV_III004860 17.m07435; cell differentiation family prot... 65.9 3e-11 sce:YNL288W CAF40; Caf40p; K12606 CCR4-NOT transcription compl... 62.0 5e-10 > tgo:TGME49_058980 cell differentiation protein Rcd1, putative ; K12606 CCR4-NOT transcription complex subunit 9 Length=356 Score = 108 bits (271), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 47/66 (71%), Positives = 56/66 (84%), Gaps = 0/66 (0%) Query 55 QQDRICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYPFL 114 +D +CQL+LDL + EKRE AL +LSKRRE +PDLAPLLW SFGT+AA+LQEIIA YP L Sbjct 78 DKDHVCQLLLDLCVLEKREAALADLSKRREQYPDLAPLLWHSFGTIAAILQEIIAIYPCL 137 Query 115 SPPSLT 120 SPP+LT Sbjct 138 SPPTLT 143 > pfa:PFE0375w cell differentiation protein rcd1, putative; K12606 CCR4-NOT transcription complex subunit 9 Length=652 Score = 101 bits (252), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 43/100 (43%), Positives = 63/100 (63%), Gaps = 0/100 (0%) Query 23 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQDRICQLVLDLSIAEKREGALLELSKR 82 + +Q Q + Q+ ++++ ++ QLV DL +EKRE ALLELS++ Sbjct 193 KDNTTSEQDQTKNDNNINNLSSGQENTINNEEEKKKVYQLVYDLCFSEKRENALLELSRK 252 Query 83 RESFPDLAPLLWFSFGTMAALLQEIIAAYPFLSPPSLTTQ 122 RE++ D+AP+LW SFGT+ LLQEI++ YP LSPP LTT Sbjct 253 RETYHDIAPVLWNSFGTITTLLQEIVSIYPQLSPPLLTTS 292 > cpv:cgd8_4460 cell differentiation protein rcd1 ; K12606 CCR4-NOT transcription complex subunit 9 Length=390 Score = 90.9 bits (224), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 0/84 (0%) Query 39 QQQQQQQQQQQQQQQQQQDRICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFG 98 + + Q++++++ Q ++D++ + KRE AL +LSK RE+FPDLAPL+W SFG Sbjct 108 SDNSGDLKGNENIIQKEREKVYQYLVDMTCSSKREMALSKLSKYRETFPDLAPLMWHSFG 167 Query 99 TMAALLQEIIAAYPFLSPPSLTTQ 122 + ALLQEII+ YP LSPP+L+ Q Sbjct 168 CITALLQEIISIYPLLSPPNLSNQ 191 > hsa:9125 RQCD1, CNOT9, CT129, RCD1, RCD1+; RCD1 required for cell differentiation1 homolog (S. pombe); K12606 CCR4-NOT transcription complex subunit 9 Length=299 Score = 89.7 bits (221), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 0/70 (0%) Query 53 QQQQDRICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYP 112 Q +++I Q + +LS E RE ALLELSK+RES PDLAP+LW SFGT+AALLQEI+ YP Sbjct 16 QVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYP 75 Query 113 FLSPPSLTTQ 122 ++PP+LT Sbjct 76 SINPPTLTAH 85 > mmu:58184 Rqcd1, 2610007F23Rik, AI593551, Fl10; rcd1 (required for cell differentiation) homolog 1 (S. pombe); K12606 CCR4-NOT transcription complex subunit 9 Length=299 Score = 89.7 bits (221), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 42/70 (60%), Positives = 54/70 (77%), Gaps = 0/70 (0%) Query 53 QQQQDRICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYP 112 Q +++I Q + +LS E RE ALLELSK+RES PDLAP+LW SFGT+AALLQEI+ YP Sbjct 16 QVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYP 75 Query 113 FLSPPSLTTQ 122 ++PP+LT Sbjct 76 SINPPTLTAH 85 > ath:AT3G20800 rcd1-like cell differentiation protein, putative; K12606 CCR4-NOT transcription complex subunit 9 Length=316 Score = 89.0 bits (219), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%) Query 61 QLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYPFLSPPSLT 120 QLVLDLS E RE ALLELSK+RE F DLAPLLW SFGT+AALLQEI++ Y L+PP+LT Sbjct 40 QLVLDLSNPELRENALLELSKKRELFQDLAPLLWNSFGTIAALLQEIVSIYSVLAPPNLT 99 > xla:432229 rqcd1, MGC78923, rcd1; RCD1 required for cell differentiation1 homolog; K12606 CCR4-NOT transcription complex subunit 9 Length=299 Score = 88.6 bits (218), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 41/70 (58%), Positives = 54/70 (77%), Gaps = 0/70 (0%) Query 53 QQQQDRICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYP 112 Q +++I Q + +LS + RE ALLELSK+RES PDLAP+LW SFGT+AALLQEI+ YP Sbjct 16 QVDREKIYQWINELSSPDTRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYP 75 Query 113 FLSPPSLTTQ 122 ++PP+LT Sbjct 76 SINPPTLTAH 85 > tpv:TP02_0463 hypothetical protein; K12606 CCR4-NOT transcription complex subunit 9 Length=327 Score = 86.7 bits (213), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%) Query 61 QLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYPFLSPPSLT 120 QL+LDLSI EKRE AL+ELSK+RE++PDLA LLW SFGT+A LL EI++ Y +L P +++ Sbjct 57 QLILDLSIPEKREYALIELSKQRENYPDLAILLWHSFGTVATLLYEIVSVYHYLYPLTIS 116 > ath:AT5G12980 rcd1-like cell differentiation protein, putative; K12606 CCR4-NOT transcription complex subunit 9 Length=311 Score = 85.9 bits (211), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 43/60 (71%), Positives = 48/60 (80%), Gaps = 0/60 (0%) Query 61 QLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYPFLSPPSLT 120 QL+LDLS E RE AL ELSK+RE F DLAPLLW S GT+ ALLQEIIA YP LSPP++T Sbjct 36 QLILDLSNPELRENALHELSKKREIFQDLAPLLWHSVGTIPALLQEIIAVYPALSPPTMT 95 > dre:406632 rqcd1, wu:fb52b11, wu:fb74e08, zgc:85618; RCD1 required for cell differentiation1 homolog (S. pombe); K12606 CCR4-NOT transcription complex subunit 9 Length=298 Score = 82.8 bits (203), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 0/70 (0%) Query 53 QQQQDRICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYP 112 Q +++I Q + +LS E RE ALLELSK+RES DLAP+LW S GT+AALLQEI+ YP Sbjct 15 QVDREKIYQWINELSSPETRENALLELSKKRESVTDLAPMLWHSCGTIAALLQEIVNIYP 74 Query 113 FLSPPSLTTQ 122 ++PP+LT Sbjct 75 SINPPTLTAH 84 > cel:C26E6.3 hypothetical protein; K12606 CCR4-NOT transcription complex subunit 9 Length=321 Score = 80.9 bits (198), Expect = 9e-16, Method: Compositional matrix adjust. Identities = 41/81 (50%), Positives = 50/81 (61%), Gaps = 0/81 (0%) Query 40 QQQQQQQQQQQQQQQQQDRICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGT 99 Q QQ D I Q ++DL KRE ALLELSK+R+S PDL LW SFGT Sbjct 11 QAQQTAVPSSANLDINTDEIMQWIIDLRDPPKREAALLELSKKRDSVPDLPIWLWHSFGT 70 Query 100 MAALLQEIIAAYPFLSPPSLT 120 M+ALLQE++A YP + P +LT Sbjct 71 MSALLQEVVAIYPAIMPANLT 91 > bbo:BBOV_III004860 17.m07435; cell differentiation family protein; K12606 CCR4-NOT transcription complex subunit 9 Length=311 Score = 65.9 bits (159), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 34/60 (56%), Positives = 41/60 (68%), Gaps = 7/60 (11%) Query 61 QLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYPFLSPPSLT 120 QL+LDL++ EKRE AL ELSK+RE PDL LLW+SFGTMA L +L P SL+ Sbjct 47 QLILDLAVPEKREYALAELSKQREHHPDLPVLLWYSFGTMATLFH-------YLHPMSLS 99 > sce:YNL288W CAF40; Caf40p; K12606 CCR4-NOT transcription complex subunit 9 Length=373 Score = 62.0 bits (149), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 4/58 (6%) Query 59 ICQLVLDLSIAEKREGALLELSKRRESFPDLAPLLWFSFGTMAALLQEIIAAYPFLSP 116 ICQL + ++E ALLEL ++RE F DLA +LW SFG M +LL EII+ YP L P Sbjct 110 ICQL----TYGPQKEQALLELGRKREQFDDLAVVLWSSFGVMTSLLNEIISVYPMLQP 163 Lambda K H 0.312 0.121 0.323 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2008132680 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40