bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_0583_orf1 Length=146 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_009300 dynein intermediate chain, putative ; K10409... 154 1e-37 xla:444304 MGC80975 protein; K10409 dynein intermediate chain ... 79.7 3e-15 hsa:27019 DNAI1, CILD1, ICS, ICS1, MGC26204, PCD; dynein, axon... 67.8 1e-11 dre:555705 zgc:158666; K10409 dynein intermediate chain 1, axo... 65.5 6e-11 mmu:68922 Dnaic1, 1110066F04Rik, BB124644, Dnai1; dynein, axon... 61.2 1e-09 pfa:PFI1080w dynein intermediate chain 2, ciliary; K10409 dyne... 57.4 2e-08 mmu:242425 Gabbr2, GABABR2, Gb2, Gm425, Gpr51; gamma-aminobuty... 35.4 0.055 hsa:9568 GABBR2, FLJ36928, GABABR2, GPR51, GPRC3B, HG20, HRIHF... 35.4 0.055 dre:560267 si:dkey-190l1.2; K04616 gamma-aminobutyric acid (GA... 32.0 0.69 bbo:BBOV_IV001930 21.m02940; hypothetical protein 31.2 1.1 ath:AT2G41150 hypothetical protein 30.8 1.5 sce:YGL139W FLC3; Flc3p 30.0 2.6 mmu:18158 Nppb, AA408272, BNP; natriuretic peptide type B; K12... 29.6 3.6 cpv:cgd7_4730 RAD23p, UB+UBA domains protein ; K10839 UV excis... 29.3 4.7 dre:100005752 MGC162803, cb117, cgn, im:7137721, sb:cb117, sb:... 28.9 5.5 hsa:4653 MYOC, GLC1A, GPOA, JOAG, JOAG1, TIGR, myocilin; myoci... 28.1 9.9 > tgo:TGME49_009300 dynein intermediate chain, putative ; K10409 dynein intermediate chain 1, axonemal Length=619 Score = 154 bits (388), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 1/145 (0%) Query 3 EDQVQLAPEELRQRMPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTL 62 +DQ+QL+PEELR+RMPP+ILYPQNPRAP+N+ +SFKE FK++ ++QTVFHL +D L Sbjct 55 KDQLQLSPEELRKRMPPRILYPQNPRAPKNLALYSFKEKVFKRDEQIDQTVFHLSVDGAL 114 Query 63 LLKDSPEAAEQEELLRLRDEAEERRRELEAVEVSIEDD-GATQEEEGRVMRNQFNNVDRA 121 L +S EA EQEE RLR+E + +++ E+V++ IEDD E+EGRV+RNQFN DRA Sbjct 115 LHAESQEAIEQEEAWRLREEEDAKKKRKESVDIRIEDDLQQNTEDEGRVLRNQFNYGDRA 174 Query 122 TQIKSCPTVEQSCSTLPPPKKLCCG 146 +Q ++ E+ +T PPP G Sbjct 175 SQTETKADRERGVATRPPPTVPVAG 199 > xla:444304 MGC80975 protein; K10409 dynein intermediate chain 1, axonemal Length=702 Score = 79.7 bits (195), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 54/156 (34%), Positives = 80/156 (51%), Gaps = 17/156 (10%) Query 4 DQVQLAPEELRQRMPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLL 63 DQ++L EL + +IL NP APQNI R+SFKE +K VEQ H +D +L Sbjct 57 DQLELTEAELNEEFT-RILTANNPHAPQNIVRYSFKERAYKPVSIVEQLAIHFSLDGNML 115 Query 64 LKDSPEAAEQEELLRLRD----------------EAEERRRELEAVEVSIEDDGATQEEE 107 KDS EA Q+ + + + EAEE A E + + +T+ + Sbjct 116 HKDSDEARRQKLRMGVLEGSTQTDTTAPETGDNMEAEEHPETPVAGEEGADREDSTKSRK 175 Query 108 GRVMRNQFNNVDRATQIKSCPTVEQSCSTLPPPKKL 143 R + NQFN +RA+Q + P E++C T PPP+++ Sbjct 176 ERKLTNQFNYSERASQSLNNPLRERACQTEPPPREV 211 > hsa:27019 DNAI1, CILD1, ICS, ICS1, MGC26204, PCD; dynein, axonemal, intermediate chain 1; K10409 dynein intermediate chain 1, axonemal Length=699 Score = 67.8 bits (164), Expect = 1e-11, Method: Composition-based stats. Identities = 51/167 (30%), Positives = 76/167 (45%), Gaps = 30/167 (17%) Query 4 DQVQLAPEELRQRMPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLL 63 DQ++L EL++ +IL NP APQNI R+SFKE +K G V Q H L+ Sbjct 53 DQLELTDAELKEEFT-RILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLI 111 Query 64 LKDSPEAAEQ---EELLRLRDEAEERRREL--------------------------EAVE 94 KDS E Q +EL+ E+ + E A + Sbjct 112 PKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEK 171 Query 95 VSIEDDGATQEEEGRVMRNQFNNVDRATQIKSCPTVEQSCSTLPPPK 141 V+ E+ ++ + R + NQFN +RA+Q + P ++ C T PPP+ Sbjct 172 VTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPR 218 > dre:555705 zgc:158666; K10409 dynein intermediate chain 1, axonemal Length=660 Score = 65.5 bits (158), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 48/147 (32%), Positives = 69/147 (46%), Gaps = 27/147 (18%) Query 4 DQVQLAPEELRQRMPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLL 63 DQ+ L EEL++ + ++L NP APQN+ R+SFKE +K V+Q H ++ L+ Sbjct 62 DQLDLTEEELKEEIT-RVLTANNPNAPQNVVRYSFKEGCYKTIVFVDQMAIHFELEGNLV 120 Query 64 LKDSPEAAEQEELLRLRDEAEERRRELEAVEVSIEDDGATQEEEGRVMR---------NQ 114 K+S E R L A ED G + E ++ NQ Sbjct 121 HKESDEG-----------------RRLMAKHTEREDCGGDERLENVPIKPGKREQKVTNQ 163 Query 115 FNNVDRATQIKSCPTVEQSCSTLPPPK 141 FN +DRA+Q + E SC T PPP+ Sbjct 164 FNFIDRASQTLNNLPREISCQTEPPPR 190 > mmu:68922 Dnaic1, 1110066F04Rik, BB124644, Dnai1; dynein, axonemal, intermediate chain 1; K10409 dynein intermediate chain 1, axonemal Length=701 Score = 61.2 bits (147), Expect = 1e-09, Method: Composition-based stats. Identities = 52/179 (29%), Positives = 72/179 (40%), Gaps = 46/179 (25%) Query 4 DQVQLAPEELRQRMPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLL 63 DQ++L EL++ +IL NP APQNI R+SFKE +K G V Q H L+ Sbjct 46 DQLELTDAELKEEFT-RILTANNPHAPQNIVRYSFKEGTYKLIGFVNQMAVHFSQVGNLI 104 Query 64 LKDSPEAAEQEELLRLRDEAEERRRE---------------------------------- 89 KDS E Q RDE +E Sbjct 105 PKDSDEGRRQH----YRDEMVAGSQESIKVVTSEAENLEEEEEPKEGEGEAEAEAEAGSQ 160 Query 90 ------LEAVEVSIEDD-GATQEEEGRVMRNQFNNVDRATQIKSCPTVEQSCSTLPPPK 141 E E IE++ A + + R + NQFN +RA+Q + P ++ C PPP+ Sbjct 161 TDIPAAAETTEKVIEEELMAPVQPKERKLTNQFNFSERASQTFNNPLRDRECQMEPPPR 219 > pfa:PFI1080w dynein intermediate chain 2, ciliary; K10409 dynein intermediate chain 1, axonemal Length=820 Score = 57.4 bits (137), Expect = 2e-08, Method: Composition-based stats. Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 0/63 (0%) Query 20 KILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLLLKDSPEAAEQEELLRL 79 + L+P+NPRA N+ +SF QF ++ TVFHL I S L+ KDS E +Q EL++ Sbjct 47 RFLFPKNPRAFTNLVEYSFSNEQFVTIENIDHTVFHLDIKSCLVRKDSDEGKKQMELIKK 106 Query 80 RDE 82 + E Sbjct 107 KIE 109 > mmu:242425 Gabbr2, GABABR2, Gb2, Gm425, Gpr51; gamma-aminobutyric acid (GABA) B receptor, 2; K04616 gamma-aminobutyric acid (GABA) B receptor 2 Length=940 Score = 35.4 bits (80), Expect = 0.055, Method: Composition-based stats. Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 8/103 (7%) Query 17 MPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLLLKDSPEAAEQEEL 76 +P I NP A RF F +NQ K++ +V + ST L+ Q E Sbjct 740 VPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLE-----GLQSEN 794 Query 77 LRLRDEAEERRRELEAVEVSIEDDGATQEEEGRVMRNQFNNVD 119 RLR + E ++LE V + ++D T E+ + +N + ++ Sbjct 795 HRLRMKITELDKDLEEVTMQLQD---TPEKTTYIKQNHYQELN 834 > hsa:9568 GABBR2, FLJ36928, GABABR2, GPR51, GPRC3B, HG20, HRIHFB2099; gamma-aminobutyric acid (GABA) B receptor, 2; K04616 gamma-aminobutyric acid (GABA) B receptor 2 Length=941 Score = 35.4 bits (80), Expect = 0.055, Method: Composition-based stats. Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 8/103 (7%) Query 17 MPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLLLKDSPEAAEQEEL 76 +P I NP A RF F +NQ K++ +V + ST L+ Q E Sbjct 741 VPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLE-----GLQSEN 795 Query 77 LRLRDEAEERRRELEAVEVSIEDDGATQEEEGRVMRNQFNNVD 119 RLR + E ++LE V + ++D T E+ + +N + ++ Sbjct 796 HRLRMKITELDKDLEEVTMQLQD---TPEKTTYIKQNHYQELN 835 > dre:560267 si:dkey-190l1.2; K04616 gamma-aminobutyric acid (GABA) B receptor 2 Length=935 Score = 32.0 bits (71), Expect = 0.69, Method: Composition-based stats. Identities = 26/110 (23%), Positives = 48/110 (43%), Gaps = 8/110 (7%) Query 17 MPPKILYPQNPRAPQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLLLKDSPEAAEQEEL 76 +P + NP A R F +NQ K++ +V + +T L Q + Sbjct 736 VPKFVTMRTNPDAATQNRRLKFTQNQKKEDSKTSTSVTSVNQANTSRLD-----GLQSDN 790 Query 77 LRLRDEAEERRRELEAVEVSIEDDGATQEEEGRVMRNQFNNVDRATQIKS 126 RLR + E +ELE V + ++D T E+ + +N + + + I++ Sbjct 791 HRLRMKITELDKELEEVTMQLQD---TPEKTPYIKQNHYQDANNILSIRN 837 > bbo:BBOV_IV001930 21.m02940; hypothetical protein Length=1006 Score = 31.2 bits (69), Expect = 1.1, Method: Compositional matrix adjust. Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 9 APEELRQRMPPKILYPQNPRAPQNITR 35 A E LR+R+P I+ P+ PR P + R Sbjct 816 AVERLRKRLPTGIIAPKKPRGPSRLAR 842 > ath:AT2G41150 hypothetical protein Length=404 Score = 30.8 bits (68), Expect = 1.5, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Query 78 RLRDEAEERRREL---EAVEVSIEDDGATQEEEGRVMRNQFNNVDRATQ 123 RLRD AE+ + +L +A+ V D T+++ RV R+QF ++DR T+ Sbjct 245 RLRDAAEKIKAKLGDYDAIHVRRGDKLKTRKDRFRVERSQFPHLDRDTR 293 > sce:YGL139W FLC3; Flc3p Length=802 Score = 30.0 bits (66), Expect = 2.6, Method: Composition-based stats. Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 4/84 (4%) Query 21 ILYPQNPR---APQNITRFSFKENQFKKEGAVEQTVFHLFIDSTLLLKDSPEAAEQEEL- 76 +L+ +NP P R SF+ N K EG V ++V + + + KD + ++ E Sbjct 582 MLFSKNPDLRFKPAKDDRTSFQRNTMKPEGTVNRSVANELLALGNVAKDHDDNSDYESND 641 Query 77 LRLRDEAEERRRELEAVEVSIEDD 100 + DE ++ + E V+ DD Sbjct 642 TGVNDELKQAQDETTPTTVTSSDD 665 > mmu:18158 Nppb, AA408272, BNP; natriuretic peptide type B; K12335 natriuretic peptide B Length=121 Score = 29.6 bits (65), Expect = 3.6, Method: Compositional matrix adjust. Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 16/71 (22%) Query 67 SPEAAEQEELLRL-RDEAEER-RRELEAVEVSIEDDGATQEEEGRVMRNQFNNV------ 118 SPE + ++LL L R+++EE +R+L ++D G T+E RV+R+Q + + Sbjct 35 SPEQFKMQKLLELIREKSEEMAQRQL------LKDQGLTKEHPKRVLRSQGSTLRVQQRP 88 Query 119 --DRATQIKSC 127 + T I SC Sbjct 89 QNSKVTHISSC 99 > cpv:cgd7_4730 RAD23p, UB+UBA domains protein ; K10839 UV excision repair protein RAD23 Length=362 Score = 29.3 bits (64), Expect = 4.7, Method: Compositional matrix adjust. Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Query 89 ELEAVEVSIEDDGATQEEEGRVMRNQFNNVDRATQIKSCPTVEQSCSTLPPP 140 ELE +I + G +E+ R MR FNN DRA VE S LP P Sbjct 154 ELEKTITNIVNMGFEREQVTRAMRAAFNNPDRA--------VEYLTSGLPIP 197 > dre:100005752 MGC162803, cb117, cgn, im:7137721, sb:cb117, sb:cb117.; si:dkey-204a24.2 Length=1161 Score = 28.9 bits (63), Expect = 5.5, Method: Compositional matrix adjust. Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Query 75 ELLR--LRDEAEERRRELEAVEVSIEDDGATQEEEGRVMRNQFNNVDRATQIKSCPTVEQ 132 +LLR L D +R REL A++ +++D+ A+ ++E +R QF+ D S TV Q Sbjct 503 QLLRQKLEDTLRQRERELTALKGALKDEVASHDKEMEALREQFSQ-DMDALRHSMETVSQ 561 Query 133 S 133 S Sbjct 562 S 562 > hsa:4653 MYOC, GLC1A, GPOA, JOAG, JOAG1, TIGR, myocilin; myocilin, trabecular meshwork inducible glucocorticoid response Length=504 Score = 28.1 bits (61), Expect = 9.9, Method: Compositional matrix adjust. Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 12/107 (11%) Query 48 AVEQTVFHLFIDSTLLLKDSPEAAEQE--ELLRLRDEAEERRRELEAVEVSIEDDGATQE 105 ++E + L +D +++ E ++E L R RD+ E + RELE ++ D + E Sbjct 94 SLESLLHQLTLDQAARPQETQEGLQRELGTLRRERDQLETQTRELETAYSNLLRDKSVLE 153 Query 106 EEGRVMRNQFNNVDRATQIKS----------CPTVEQSCSTLPPPKK 142 EE + +R + N+ R + S CP + +PP + Sbjct 154 EEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSR 200 Lambda K H 0.313 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2872883024 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40