bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1159_orf2 Length=139 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_049200 ctr copper transporter domain-containing pro... 82.4 3e-16 pfa:PF14_0211 Ctr copper transporter domain containing protein... 50.8 1e-06 pfa:PF14_0369 copper transporter putative; K14686 solute carri... 47.0 2e-05 tgo:TGME49_062710 ctr copper transporter domain-containing pro... 43.1 3e-04 cel:F58G6.3 hypothetical protein 38.9 0.005 bbo:BBOV_II005100 18.m09998; hypothetical protein; K14686 solu... 38.1 0.007 dre:555698 peptidylprolyl isomerase F-like 33.5 0.21 dre:100317326 si:ch1073-55a19.2; K12172 E3 SUMO-protein ligase... 32.7 0.37 cel:Y58A7A.1 hypothetical protein 32.3 0.41 tgo:TGME49_025260 DNA-directed RNA polymerase II largest subun... 31.2 0.95 cel:K12C11.6 hypothetical protein 29.6 3.0 hsa:10980 COPS6, CSN6, MOV34-34KD; COP9 constitutive photomorp... 29.6 3.1 dre:558502 ryk, wu:fb37b12, wu:fi05b06, zgc:158381; receptor-l... 28.5 6.3 cel:F58G6.9 hypothetical protein 28.5 7.0 > tgo:TGME49_049200 ctr copper transporter domain-containing protein ; K14686 solute carrier family 31 (copper transporter), member 1 Length=235 Score = 82.4 bits (202), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 41/88 (46%), Positives = 52/88 (59%), Gaps = 0/88 (0%) Query 52 ALPLPMWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKVLRRLSEAHLKMS 111 +PLPM FE ST V+ LF W TT Q+ CV + GFI + LKV+RR E L Sbjct 71 GMPLPMAFEVSTRVIYLFEDWPTETTTQFAGACVATCILGFICVILKVVRRYVEKSLVSQ 130 Query 112 EQKGKPTLLLGSLPVYQNAIRGSVAFLN 139 E GK L+ GS P+Y N++R VAF+N Sbjct 131 ENVGKTKLIFGSFPLYSNSVRFLVAFVN 158 > pfa:PF14_0211 Ctr copper transporter domain containing protein, putative Length=160 Score = 50.8 bits (120), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 29/116 (25%), Positives = 58/116 (50%), Gaps = 2/116 (1%) Query 24 AFCTAALFPLISTASIRVNTDCAMLDKCALPLPMWFEASTEVLLLFSWWNGRTTAQYIVC 83 + T A+F L T ++ C + + LPM+F + + +LF + + Q+I C Sbjct 10 KYYTLAIFCLTFTFDFVSSSCCHSKNDDGVMLPMYFSNNENIKMLFDIFQVKNRYQFIFC 69 Query 84 CVCCIVFGFISIALKVLRRLSEAHLKMSEQKGKPTLLLGSLPVYQNAIRGSVAFLN 139 + CI+ GF S+ +KVL++ +++ G + + ++ QN G ++FL+ Sbjct 70 NILCIIMGFFSVYIKVLKKRLHHNVQKVADGGDGSYV--NMSPCQNVNYGFLSFLH 123 > pfa:PF14_0369 copper transporter putative; K14686 solute carrier family 31 (copper transporter), member 1 Length=235 Score = 47.0 bits (110), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 4/75 (5%) Query 55 LPMWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKVLRRLSEAHLKMSEQK 114 +PM F+ +T ++LF+ W ++ Y + V C FG IS+ KV+R E L +E Sbjct 91 MPMSFQLTTHTIILFNKWETKSALSYYISLVLCFFFGIISVGFKVVRLNVEQALPKTED- 149 Query 115 GKPTLLLGSLPVYQN 129 T + SL +++N Sbjct 150 ---TNIFKSLVLFKN 161 > tgo:TGME49_062710 ctr copper transporter domain-containing protein Length=375 Score = 43.1 bits (100), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 24/108 (22%) Query 55 LPMWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKVLR-----------RL 103 +PM F+ S ++LF W QY++ + C+V G +S+ LKVLR R Sbjct 206 MPMSFQNSLHTVILFHSWETLERWQYVLSLLTCVVLGMLSVVLKVLRLRLEFFLAKRDRA 265 Query 104 SEAHL---KMSEQKGKP----------TLLLGSLPVYQNAIRGSVAFL 138 +E K+ E++G+ L G+ P+ QN+ R AF+ Sbjct 266 AEDAQRVEKLKEKEGQSSAASPSSAIVERLCGNFPLKQNSWRMLEAFV 313 > cel:F58G6.3 hypothetical protein Length=134 Score = 38.9 bits (89), Expect = 0.005, Method: Compositional matrix adjust. Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Query 41 VNTDCAMLDKCALP-LPMWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKV 99 +N + +D P + MWF + +LFS WN + + + C+ + G I A+K Sbjct 1 MNHNSMDMDMNQGPFMWMWFHTKPQDTVLFSTWNITSAGKMVWACILVAIAGIILEAIKY 60 Query 100 LRRLSEAHLKMSEQKGKPTLLLGSLPVYQ 128 RRL + S+++ + LL ++ +Q Sbjct 61 NRRLIQKRQSPSKKESYISRLLSTMHFFQ 89 > bbo:BBOV_II005100 18.m09998; hypothetical protein; K14686 solute carrier family 31 (copper transporter), member 1 Length=297 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 0/68 (0%) Query 55 LPMWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKVLRRLSEAHLKMSEQK 114 +PM+FE + + ++LF +W T QY V V +++ LK R L Sbjct 163 MPMYFENTVKTVILFHFWKTTTGTQYAVSLFFIFVLSLMTVFLKAFRNKLNCALLQRPNG 222 Query 115 GKPTLLLG 122 PT+ G Sbjct 223 YHPTVKYG 230 > dre:555698 peptidylprolyl isomerase F-like Length=336 Score = 33.5 bits (75), Expect = 0.21, Method: Compositional matrix adjust. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Query 88 IVFGFISIALKVLRRLSEAHLKMSEQKGKPTLLL 121 +VFGFI + VLRR+ E M ++GKPT + Sbjct 299 VVFGFIREGMNVLRRIGE----MGSKEGKPTHRI 328 > dre:100317326 si:ch1073-55a19.2; K12172 E3 SUMO-protein ligase RanBP2 Length=2950 Score = 32.7 bits (73), Expect = 0.37, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 4/31 (12%) Query 88 IVFGFISIALKVLRRLSEAHLKMSEQKGKPT 118 + FGF++ ++VLRRL+E M ++GKPT Sbjct 2913 VAFGFVTDGMQVLRRLAE----MGTKEGKPT 2939 > cel:Y58A7A.1 hypothetical protein Length=130 Score = 32.3 bits (72), Expect = 0.41, Method: Compositional matrix adjust. Identities = 17/69 (24%), Positives = 27/69 (39%), Gaps = 0/69 (0%) Query 57 MWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKVLRRLSEAHLKMSEQKGK 116 M F TE +LF +W T V C ++ F+ L+ R +A ++ + Sbjct 1 MSFHFGTEETILFDFWKTETAVGIAVACFITVLLAFLMETLRFFRDYRKAQTQLHQPPIS 60 Query 117 PTLLLGSLP 125 P L P Sbjct 61 PEDRLKRSP 69 > tgo:TGME49_025260 DNA-directed RNA polymerase II largest subunit, putative (EC:2.7.7.6 3.5.1.16); K03006 DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6] Length=1892 Score = 31.2 bits (69), Expect = 0.95, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Query 96 ALKVLRRLSEAHLKM----SEQKGKPTLLLGSLPVYQNAIRGSVAF 137 A VLRR+SE LKM E+ + +L +LP+ A+R SV + Sbjct 216 AYAVLRRISEEDLKMMGFDPERAHPASFILSTLPIPPLAVRPSVQY 261 > cel:K12C11.6 hypothetical protein Length=132 Score = 29.6 bits (65), Expect = 3.0, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query 55 LPMWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKVLR-RLSEAHLKMSE 112 + MWF T+ +LF WN T + C +V G + +K LR ++ + H E Sbjct 9 MHMWFHTKTQDTVLFKTWNVTDTPTMVWVCCIIVVAGILLELIKFLRWKIEKWHKNRDE 67 > hsa:10980 COPS6, CSN6, MOV34-34KD; COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis); K12179 COP9 signalosome complex subunit 6 Length=327 Score = 29.6 bits (65), Expect = 3.1, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Query 78 AQYIVCCVCCIVFGFISIALK--VLRRLSEAHLKMSEQKGKPTLLLGSL 124 A + + C V G +S+AL V+ +S+ ++M Q+G+P ++G+L Sbjct 24 AAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIGAL 72 > dre:558502 ryk, wu:fb37b12, wu:fi05b06, zgc:158381; receptor-like tyrosine kinase (EC:2.7.10.1); K05128 RYK receptor-like tyrosine kinase [EC:2.7.10.1] Length=604 Score = 28.5 bits (62), Expect = 6.3, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 80 YIVCCVCCIVFGFISIALKVLRRLSEAHLKM 110 YI CVCCIV ++I L VL S ++M Sbjct 227 YISVCVCCIVIFLVAIILAVLHLHSMKRVEM 257 > cel:F58G6.9 hypothetical protein Length=156 Score = 28.5 bits (62), Expect = 7.0, Method: Compositional matrix adjust. Identities = 15/72 (20%), Positives = 27/72 (37%), Gaps = 0/72 (0%) Query 55 LPMWFEASTEVLLLFSWWNGRTTAQYIVCCVCCIVFGFISIALKVLRRLSEAHLKMSEQK 114 + MW+ E +LF W + C G + ALK R +E +K+ ++ Sbjct 21 MWMWYHVDVEDTVLFKSWTVFDAGTMVWTCFVVAAAGILLEALKYARWATEERMKIDQEN 80 Query 115 GKPTLLLGSLPV 126 G + + Sbjct 81 VDSKTKYGGIKI 92 Lambda K H 0.330 0.140 0.463 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2487377096 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40