bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1420_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 i... 157 7e-39 eco:b2821 ptrA, ECK2817, JW2789, ptr; protease III (EC:3.4.24.... 50.8 1e-06 ath:AT1G06900 catalytic/ metal ion binding / metalloendopeptid... 50.8 1e-06 ath:AT3G57470 peptidase M16 family protein / insulinase family... 44.7 7e-05 dre:557565 nrd1, si:dkey-171o17.4; nardilysin (N-arginine diba... 42.4 4e-04 ath:AT2G41790 peptidase M16 family protein / insulinase family... 41.2 8e-04 cel:C02G6.2 hypothetical protein; K01408 insulysin [EC:3.4.24.56] 41.2 8e-04 hsa:4898 NRD1, hNRD1, hNRD2; nardilysin (N-arginine dibasic co... 40.0 0.002 mmu:230598 Nrd1, 2600011I06Rik, AI875733, MGC25477, NRD-C; nar... 38.9 0.004 cel:F44E7.4 hypothetical protein; K01408 insulysin [EC:3.4.24.56] 36.2 0.024 cel:C28F5.4 hypothetical protein; K01408 insulysin [EC:3.4.24.56] 35.4 0.041 tgo:TGME49_069890 M16 family peptidase, putative (EC:3.4.24.56) 33.9 0.12 dre:565850 fk24c07; wu:fk24c07; K01411 nardilysin [EC:3.4.24.61] 32.3 0.37 cel:C02G6.1 hypothetical protein; K01408 insulysin [EC:3.4.24.56] 32.3 0.37 cpv:cgd3_4190 secreted insulinase like peptidase 32.3 0.41 cpv:cgd1_1680 insulinase like protease, signal peptide ; K0140... 31.6 0.64 cpv:cgd2_920 peptidase'insulinase-like peptidase' 30.8 1.2 sce:YLR389C STE23; Metalloprotease involved, with homolog Axl1... 30.4 1.5 sce:YOR142W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.1 sce:YPR158W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.2 sce:YOL103W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.2 sce:YLR157C-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.2 sce:YMR050C Retrotransposon TYA Gag and TYB Pol genes; transcr... 28.5 5.3 sce:YGR161C-D Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.3 sce:YDR210C-D Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.3 sce:YBR012W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.3 sce:YPL257W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.4 sce:YPR137C-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.4 sce:YML045W Retrotransposon TYA Gag and TYB Pol genes; transcr... 28.5 5.4 sce:YJR029W Retrotransposon TYA Gag and TYB Pol genes; transcr... 28.5 5.4 sce:YHR214C-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.4 sce:YDR316W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.4 cpv:cgd2_930 peptidase'insulinase-like peptidase' ; K01408 ins... 28.5 5.5 sce:YER138C Retrotransposon TYA Gag and TYB Pol genes; transcr... 28.5 5.6 sce:YDR365W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.6 sce:YDR098C-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.6 sce:YPR158C-D Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.7 sce:YML039W Retrotransposon TYA Gag and TYB Pol genes; transcr... 28.5 5.7 sce:YJR027W Retrotransposon TYA Gag and TYB Pol genes; transcr... 28.5 5.7 sce:YDR261C-D Retrotransposon TYA Gag and TYB Pol genes; in YD... 28.5 5.8 sce:YER160C Retrotransposon TYA Gag and TYB Pol genes; transcr... 28.5 5.9 sce:YGR038C-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.5 5.9 sce:YLR227W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.1 6.2 sce:YGR027W-B Retrotransposon TYA Gag and TYB Pol genes; trans... 28.1 6.2 mmu:15925 Ide, 1300012G03Rik, 4833415K22Rik, AA675336, AI50753... 27.7 9.2 > tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 insulysin [EC:3.4.24.56] Length=953 Score = 157 bits (397), Expect = 7e-39, Method: Compositional matrix adjust. Identities = 71/121 (58%), Positives = 93/121 (76%), Gaps = 0/121 (0%) Query 1 RLLGLADGISPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELV 60 R +GLAD +S DR S+STL +KVDL KGA+ RG VL+E+FSYIN L++ GV + + Sbjct 327 RTMGLADEVSVVADRTSVSTLFAVKVDLASKGASERGAVLEEVFSYINLLKNEGVDSKTI 386 Query 61 STMAQQSHIDFHTTQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLLQE 120 S++++QS +DFHT+QP M+E ARLAHNLLTYEPYHV+AGDSLL+D D + NQLL + Sbjct 387 SSISEQSLVDFHTSQPDPPAMNEVARLAHNLLTYEPYHVLAGDSLLVDPDAQFVNQLLDK 446 Query 121 M 121 M Sbjct 447 M 447 > eco:b2821 ptrA, ECK2817, JW2789, ptr; protease III (EC:3.4.24.55); K01407 protease III [EC:3.4.24.55] Length=962 Score = 50.8 bits (120), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 29/71 (40%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Query 4 GLADGISPAVDR--NSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVS 61 GL +GIS D N S +L I LT KG A+R V+ IFSY+N LR+ G+ + Sbjct 331 GLVEGISANSDPIVNGNSGVLAISASLTDKGLANRDQVVAAIFSYLNLLREKGIDKQYFD 390 Query 62 TMAQQSHIDFH 72 +A IDF Sbjct 391 ELANVLDIDFR 401 > ath:AT1G06900 catalytic/ metal ion binding / metalloendopeptidase/ zinc ion binding; K01411 nardilysin [EC:3.4.24.61] Length=1024 Score = 50.8 bits (120), Expect = 1e-06, Method: Composition-based stats. Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 5/109 (4%) Query 12 AVDRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDF 71 ++R+S++ + G+ + LT G ++ I+ Y+ LRD + + ++DF Sbjct 386 GINRSSLAYVFGMSIHLTDSGLEKIYDIIGYIYQYLKLLRDVSPQEWIFKELQDIGNMDF 445 Query 72 H--TTQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLL 118 QP+ D AA L+ N+L Y HV+ GD + DP+L L+ Sbjct 446 RFAEEQPAD---DYAAELSENMLAYPVEHVIYGDYVYQTWDPKLIEDLM 491 > ath:AT3G57470 peptidase M16 family protein / insulinase family protein; K01408 insulysin [EC:3.4.24.56] Length=891 Score = 44.7 bits (104), Expect = 7e-05, Method: Composition-based stats. Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 2/122 (1%) Query 1 RLLGLADGI-SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHEL 59 ++LG A G+ + D + + + +DLT G H +L +F YI L+ GV + Sbjct 239 KILGWATGLYAGEADWSMEYSFFNVSIDLTDAGHEHMQDILGLLFEYIKVLQQSGVSQWI 298 Query 60 VSTMAQQSHIDFHTTQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLLQ 119 ++ +FH Q + A ++ N+ Y H + G SL +P + ++L Sbjct 299 FDELSAICEAEFH-YQAKIDPISYAVDISSNMKIYPTKHWLVGSSLPSKFNPAIVQKVLD 357 Query 120 EM 121 E+ Sbjct 358 EL 359 > dre:557565 nrd1, si:dkey-171o17.4; nardilysin (N-arginine dibasic convertase) (EC:3.4.24.61) Length=1061 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 23/102 (22%), Positives = 49/102 (48%), Gaps = 1/102 (0%) Query 14 DRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDFHT 73 D+NS ++ I + L+ +G + V+ IF Y+ L+ G + + + +FH Sbjct 400 DQNSTYSIFSISITLSDEGLQNFLQVIHIIFQYLKMLQSVGPQQRIYEEIQKIEANEFHY 459 Query 74 TQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTN 115 + + I + A ++ N+ + H + GD L+ D +P ++ Sbjct 460 QEQTEPI-EFVANMSENMQLFPKEHFLCGDQLMFDFNPEASH 500 > ath:AT2G41790 peptidase M16 family protein / insulinase family protein; K01408 insulysin [EC:3.4.24.56] Length=970 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 8/125 (6%) Query 1 RLLGLADGISPAVDRNSIS-TLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHEL 59 + LG A G+S ++ + + +DLT G H +L +F+YI L+ GV + Sbjct 312 KTLGWATGLSAGEGEWTLDYSFFKVSIDLTDAGHEHMQEILGLLFNYIQLLQQTGVCQWI 371 Query 60 VSTMAQQSHIDFHTTQ---PSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQ 116 ++ FH P S I+D +A N+ Y + G SL +P + + Sbjct 372 FDELSAICETKFHYQDKIPPMSYIVD----IASNMQIYPTKDWLVGSSLPTKFNPAIVQK 427 Query 117 LLQEM 121 ++ E+ Sbjct 428 VVDEL 432 > cel:C02G6.2 hypothetical protein; K01408 insulysin [EC:3.4.24.56] Length=816 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 32/123 (26%), Positives = 60/123 (48%), Gaps = 8/123 (6%) Query 3 LGLADGISPAVDRNSISTLLG---IKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHEL 59 LG A + P + +I+ G + +DL+ +G H ++Q +F+YI L+ G + Sbjct 316 LGWASSLKP--ESKTIAAGFGYFNVTMDLSTEGLEHVDEIIQLMFNYIGMLQSAGPQQWI 373 Query 60 VSTMAQQSHIDFHTTQPSSSIMDEAARLAHNLLTYEPY-HVVAGDSLLIDADPRLTNQLL 118 +A+ S I+F + + A ++A N L Y P+ H+++ LL +P +LL Sbjct 374 HEELAELSAIEFR-FKDREPLTKNAIKVARN-LQYIPFEHILSSRYLLTKYNPERIKELL 431 Query 119 QEM 121 + Sbjct 432 STL 434 > hsa:4898 NRD1, hNRD1, hNRD2; nardilysin (N-arginine dibasic convertase) (EC:3.4.24.61); K01411 nardilysin [EC:3.4.24.61] Length=1151 Score = 40.0 bits (92), Expect = 0.002, Method: Composition-based stats. Identities = 23/108 (21%), Positives = 48/108 (44%), Gaps = 1/108 (0%) Query 14 DRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDFHT 73 ++NS ++ I + LT +G H V +F Y+ L+ G + + + +FH Sbjct 496 EQNSTYSVFSISITLTDEGYEHFYEVAYTVFQYLKMLQKLGPEKRIFEEIRKIEDNEFH- 554 Query 74 TQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLLQEM 121 Q + ++ + N+ Y ++ GD LL + P + + L ++ Sbjct 555 YQEQTDPVEYVENMCENMQLYPLQDILTGDQLLFEYKPEVIGEALNQL 602 > mmu:230598 Nrd1, 2600011I06Rik, AI875733, MGC25477, NRD-C; nardilysin, N-arginine dibasic convertase, NRD convertase 1 (EC:3.4.24.61); K01411 nardilysin [EC:3.4.24.61] Length=1161 Score = 38.9 bits (89), Expect = 0.004, Method: Composition-based stats. Identities = 23/108 (21%), Positives = 47/108 (43%), Gaps = 1/108 (0%) Query 14 DRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDFHT 73 ++NS ++ I + LT +G H V +F Y+ L+ G + + + +FH Sbjct 507 EQNSTYSVFSISITLTDEGYEHFYEVAHTVFQYLKMLQKLGPEKRVFEEIQKIEDNEFH- 565 Query 74 TQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLLQEM 121 Q + ++ + N+ Y + GD LL + P + + L ++ Sbjct 566 YQEQTDPVEYVENMCENMQLYPRQDFLTGDQLLFEYKPEVIAEALNQL 613 > cel:F44E7.4 hypothetical protein; K01408 insulysin [EC:3.4.24.56] Length=1051 Score = 36.2 bits (82), Expect = 0.024, Method: Composition-based stats. Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 9/99 (9%) Query 24 IKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDFH---TTQPSSSI 80 + +DL+ +G H ++Q +F+YI L+ G + +A+ S + F QP + Sbjct 397 VTMDLSTEGLEHVDEIIQLMFNYIGMLQSAGPKQWVHDELAELSAVKFRFKDKEQPMTMA 456 Query 81 MDEAARLAHNLLTYEPY-HVVAGDSLLIDADPRLTNQLL 118 ++ AA L Y P+ H+++ LL +P +LL Sbjct 457 INVAAS-----LQYIPFEHILSSRYLLTKYEPERIKELL 490 > cel:C28F5.4 hypothetical protein; K01408 insulysin [EC:3.4.24.56] Length=856 Score = 35.4 bits (80), Expect = 0.041, Method: Composition-based stats. Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 4/86 (4%) Query 9 ISPAVDRNSISTLLGI---KVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQ 65 IS D ++I++ G+ +DL+ +G H V+Q +F++I FL+ G + +A+ Sbjct 321 ISLEADNHTIASGFGVFSVTMDLSTEGLEHVDDVIQLVFNFIGFLKSSGPQKWIHDELAE 380 Query 66 QSHIDFHTTQPSSSIMDEAARLAHNL 91 + +DF + M++A+ LA L Sbjct 381 LNAVDFRFDDVKHT-MEKASILAECL 405 > tgo:TGME49_069890 M16 family peptidase, putative (EC:3.4.24.56) Length=941 Score = 33.9 bits (76), Expect = 0.12, Method: Composition-based stats. Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 7/107 (6%) Query 18 ISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHE---LVSTMAQQSHIDF-HT 73 + T+L + V LT+ G + V + + FLR+ GV V+ MA+ + F Sbjct 343 LCTVLQVNVRLTEGGRSKES-VYKIGHALFTFLRNLGVSRPERWRVTEMAKIRQLGFAFA 401 Query 74 TQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLLQE 120 P + R L Y P V+AGD L+ DP + Q +Q+ Sbjct 402 DMPDPYAL--TVRAVEGLNYYTPEEVIAGDRLIYHFDPDIIQQYVQK 446 > dre:565850 fk24c07; wu:fk24c07; K01411 nardilysin [EC:3.4.24.61] Length=1091 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 20/105 (19%), Positives = 45/105 (42%), Gaps = 1/105 (0%) Query 14 DRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDFHT 73 D+N+ ++ I + LT +G + V +F Y+ L+ G + + + +FH Sbjct 431 DQNTTYSIFSISITLTDEGFQNFYEVAHLVFQYLKMLQTLGPQQRIYEEIQKIEANEFHY 490 Query 74 TQPSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLL 118 + + I + + N+ + + GD L+ + P + + L Sbjct 491 QEQTDPI-EYVEDICENMQLFPKEDFLTGDQLMFEFKPEVISAAL 534 > cel:C02G6.1 hypothetical protein; K01408 insulysin [EC:3.4.24.56] Length=980 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 12/115 (10%) Query 14 DRNSIST---LLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHID 70 D N+I+ +L + +DL+ G + ++Q + +YI L+ G + +A S + Sbjct 298 DSNTIAAGFGILNVTMDLSTGGLENVDEIIQLMLNYIGMLKSFGPQQWIHDELADLSDVK 357 Query 71 FH---TTQPSSSIMDEAARLAHNLLTYEPY-HVVAGDSLLIDADPRLTNQLLQEM 121 F QP ++ AA L Y P H+++ LL +P +LL + Sbjct 358 FRFKDKEQPMKMAINIAAS-----LQYIPIEHILSSRYLLTKYEPERIKELLSTL 407 > cpv:cgd3_4190 secreted insulinase like peptidase Length=1085 Score = 32.3 bits (72), Expect = 0.41, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Query 19 STLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDFHTTQPSS 78 +T+L ++V+LT+KG + ++++ I SY+N ++ L + Q+ ++H T+ S+ Sbjct 377 TTILYLEVNLTKKGLQNIPIIIESIASYLNLIKRTVASDRLFA--EAQNLFNYHLTK-ST 433 Query 79 SIMDEA 84 I+ EA Sbjct 434 VILSEA 439 > cpv:cgd1_1680 insulinase like protease, signal peptide ; K01408 insulysin [EC:3.4.24.56] Length=1033 Score = 31.6 bits (70), Expect = 0.64, Method: Composition-based stats. Identities = 21/99 (21%), Positives = 49/99 (49%), Gaps = 2/99 (2%) Query 25 KVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDF--HTTQPSSSIMD 82 +++LT +G ++ ++ I+ YIN L++ ++ + + +F +T SS M Sbjct 367 QLELTSEGLKNQFEIIGLIYKYINKLKESKELLKVYQGIRSLTEREFITNTEMLESSPMH 426 Query 83 EAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQLLQEM 121 + + ++ Y + ++GD L+ D D L ++L + Sbjct 427 STSEICSKMIQYGVHAALSGDILIEDVDENLIYEILNAI 465 > cpv:cgd2_920 peptidase'insulinase-like peptidase' Length=1028 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 27/82 (32%), Positives = 36/82 (43%), Gaps = 1/82 (1%) Query 1 RLLGLADGISPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELV 60 R LA G S A+ L V LT +G + G VL+ IF+++ + V ELV Sbjct 320 RAKKLATGASFAITNEDPCALAQFGVVLTDEGYNNIGQVLEIIFNFLVLFKATPVIPELV 379 Query 61 STMAQQSHIDFHTTQPSSSIMD 82 + F T QP SI D Sbjct 380 DEFIGITRAGF-TYQPKFSIRD 400 > sce:YLR389C STE23; Metalloprotease involved, with homolog Axl1p, in N-terminal processing of pro-A-factor to the mature form; member of the insulin-degrading enzyme family (EC:3.4.24.-); K01408 insulysin [EC:3.4.24.56] Length=1027 Score = 30.4 bits (67), Expect = 1.5, Method: Composition-based stats. Identities = 26/101 (25%), Positives = 41/101 (40%), Gaps = 6/101 (5%) Query 19 STLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVSTMAQQSHIDFHTTQ--- 75 + + +DLT G H V+ IF YI L++ + + + S+ F Q Sbjct 380 NAFFAVDIDLTDNGLTHYRDVIVLIFQYIEMLKNSLPQKWIFNELQDISNATFKFKQAGS 439 Query 76 PSSSIMDEAARLAHNLLTYEPYHVVAGDSLLIDADPRLTNQ 116 PSS++ A L + Y P + LL +P L Q Sbjct 440 PSSTVSSLAKCLEKD---YIPVSRILAMGLLTKYEPDLLTQ 477 > sce:YOR142W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.1, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YPR158W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1756 Score = 28.5 bits (62), Expect = 5.2, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YOL103W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.2, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YLR157C-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.2, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YMR050C Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YGR161C-D Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YDR210C-D Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YBR012W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1756 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YPL257W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YPR137C-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YML045W Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YJR029W Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YHR214C-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1793 Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 447 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 506 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 507 IRSAHHIHSASSNPDINVVDAQKR 530 > sce:YDR316W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.4, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > cpv:cgd2_930 peptidase'insulinase-like peptidase' ; K01408 insulysin [EC:3.4.24.56] Length=1013 Score = 28.5 bits (62), Expect = 5.5, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Query 3 LGLADGISPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQEIFSYINFLRDHGVGHELVST 62 L L+ G++ N L I + LT+KGA V++ +++N + + + E+VS Sbjct 330 LALSSGLNEMYSAN----LFEIIITLTEKGAREVLSVIEYTLNFVNLVIKNEIDMEVVSD 385 Query 63 MAQQSHIDF-HTTQPS 77 + + S + F + +PS Sbjct 386 LEKLSQLVFDYRNRPS 401 > sce:YER138C Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.6, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YDR365W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.6, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YDR098C-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.6, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPGINVVDAQKR 492 > sce:YPR158C-D Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.7, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YML039W Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.7, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YJR027W Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.7, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YDR261C-D Retrotransposon TYA Gag and TYB Pol genes; in YDRCTY1-3 TYB is mutant and probably non-functional (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1604 Score = 28.5 bits (62), Expect = 5.8, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YER160C Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.9, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQKLTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YGR038C-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.5 bits (62), Expect = 5.9, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPGINVVDAQKR 492 > sce:YLR227W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.1 bits (61), Expect = 6.2, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > sce:YGR027W-B Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes (EC:3.4.23.- 3.1.26.4 2.7.7.7 2.7.7.49) Length=1755 Score = 28.1 bits (61), Expect = 6.2, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 37/84 (44%), Gaps = 7/84 (8%) Query 10 SPAVDRNSISTLLGIKVDLTQKGAAHRGLVLQE-IFSYINFLRDHGVGHELVSTMAQQS- 67 SP+ D +SIS + L K H G L E ++ N D GH L+ + A ++ Sbjct 409 SPSTDNDSISKSTTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTL 468 Query 68 -----HIDFHTTQPSSSIMDEAAR 86 HI ++ P +++D R Sbjct 469 IRSAHHIHSASSNPDINVVDAQKR 492 > mmu:15925 Ide, 1300012G03Rik, 4833415K22Rik, AA675336, AI507533; insulin degrading enzyme (EC:3.4.24.56); K01408 insulysin [EC:3.4.24.56] Length=1019 Score = 27.7 bits (60), Expect = 9.2, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 0/31 (0%) Query 24 IKVDLTQKGAAHRGLVLQEIFSYINFLRDHG 54 I VDLT++G H ++ +F YI LR G Sbjct 375 INVDLTEEGLLHVEDIILHMFQYIQKLRAEG 405 Lambda K H 0.320 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2013067560 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40