bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_1577_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_055260 apical membrane antigen 1, putative ; K13845... 105 4e-23 tgo:TGME49_115730 apical membrane antigen, putative 93.2 2e-19 tgo:TGME49_100130 apical membrane antigen, putative ; K13845 a... 76.6 2e-14 pfa:PF11_0344 AMA1, AMA-1, Pf83, RMA-1, RMA1; apical membrane ... 57.8 8e-09 bbo:BBOV_IV011230 23.m06405; apical membrane antigen 1; K13845... 57.0 1e-08 tpv:TP01_0650 apical membrane antigen 1; K13845 apical merozoi... 49.7 2e-06 dre:100330606 RETRotransposon-like family member (retr-1)-like 32.3 0.41 dre:100333905 RETRotransposon-like family member (retr-1)-like 30.8 1.2 dre:100329991 LReO_3-like 30.4 1.3 dre:100005980 LReO_3-like 30.4 1.5 dre:100330549 RETRotransposon-like family member (retr-1)-like 30.4 1.5 dre:100330758 RETRotransposon-like family member (retr-1)-like 29.6 2.5 ath:AT5G58970 ATUCP2; ATUCP2 (UNCOUPLING PROTEIN 2); oxidative... 29.3 3.1 cpv:cgd5_830 membrane associated protein with a transmembrane ... 28.5 5.3 ath:AT4G19130 DNA binding / nucleic acid binding / zinc ion bi... 28.5 6.2 hsa:729830 FAM160A1, FLJ43373; family with sequence similarity... 28.1 6.6 mmu:229473 D930015E06Rik, Kiaa0922, mKIAA0922; RIKEN cDNA D930... 28.1 6.7 bbo:BBOV_III006150 17.m07545; ribosomal protein S9 27.7 8.6 > tgo:TGME49_055260 apical membrane antigen 1, putative ; K13845 apical merozoite antigen 1 Length=569 Score = 105 bits (261), Expect = 4e-23, Method: Composition-based stats. Identities = 56/111 (50%), Positives = 74/111 (66%), Gaps = 4/111 (3%) Query 16 RRRRQPTDAALHQPNDNPFLVP-PLSDFMDRFNIPKVLGSGIYVDLGGDKEVDGRTCREP 74 R R T +A + NPF + FM+RFN+ SGIYVDLG DKEVDG REP Sbjct 56 RSRESQTLSA--STSGNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREP 113 Query 75 SGLCPVFGKTIVLYQPQNNPNYKNDFLDDIPTKQQSDAVGHPLPGGFNNSF 125 +GLCP++GK I L QP + P Y+N+FL+D+PT+++ G+PLPGGFN +F Sbjct 114 AGLCPIWGKHIELQQP-DRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNF 163 > tgo:TGME49_115730 apical membrane antigen, putative Length=388 Score = 93.2 bits (230), Expect = 2e-19, Method: Composition-based stats. Identities = 57/118 (48%), Positives = 65/118 (55%), Gaps = 24/118 (20%) Query 21 PTDAALHQPND--------------NPF-LVPPLSDFMDRFNIPKVLGSGIYVDLGGDKE 65 P DA L PN NP+ +DFM RFNIP+V GSGI+VDLG D E Sbjct 73 PLDATLSAPNSFGEQEARSVEAVKQNPWATTTAFADFMKRFNIPQVHGSGIFVDLGRDTE 132 Query 66 VDGRTCREPSGLCPVFGKTIVLYQPQNNPNYKNDFLDDIPTKQQSDAVGHPLPGGFNN 123 RE G CPVFGK I ++QP Y N+FLDD PT +DA PLPGGFNN Sbjct 133 ----GYREVGGKCPVFGKAIQMHQP---AEYSNNFLDDAPT--SNDASKKPLPGGFNN 181 > tgo:TGME49_100130 apical membrane antigen, putative ; K13845 apical merozoite antigen 1 Length=493 Score = 76.6 bits (187), Expect = 2e-14, Method: Composition-based stats. Identities = 38/85 (44%), Positives = 49/85 (57%), Gaps = 2/85 (2%) Query 38 PLSDFMDRFNIPKVLGSGIYVDLGGDKEVDGRTCREPSGLCPVFGKTIVLYQPQNNPN-Y 96 P + ++R+N+P V GSG+YVDLG K + + REP G CP +GK I YQP NP + Sbjct 56 PWAKILERYNVPLVHGSGVYVDLGNTKILSKKKYREPGGKCPNYGKYIKTYQPTTNPEIW 115 Query 97 KNDFLDDIPTKQQSDAVGHPLPGGF 121 NDFL +P PL GGF Sbjct 116 PNDFLKPVPYANTPQDT-MPLGGGF 139 > pfa:PF11_0344 AMA1, AMA-1, Pf83, RMA-1, RMA1; apical membrane antigen 1, AMA1; K13845 apical merozoite antigen 1 Length=622 Score = 57.8 bits (138), Expect = 8e-09, Method: Composition-based stats. Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 6/72 (8%) Query 38 PLSDFMDRFNIPKVLGSGIYVDLGGDKEVDGRTCREPSGLCPVFGKTIVLYQPQNNPNYK 97 P +++M +++I +V GSGI VDLG D EV G R PSG CPVFGK I++ N Sbjct 109 PWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIII------ENSN 162 Query 98 NDFLDDIPTKQQ 109 FL + T Q Sbjct 163 TTFLTPVATGNQ 174 > bbo:BBOV_IV011230 23.m06405; apical membrane antigen 1; K13845 apical merozoite antigen 1 Length=605 Score = 57.0 bits (136), Expect = 1e-08, Method: Composition-based stats. Identities = 32/73 (43%), Positives = 41/73 (56%), Gaps = 7/73 (9%) Query 38 PLSDFMDRFNIPKVLGSGIYVDLGGDKEVDGRTCREPSGLCPVFGKTIVLYQPQNNPNYK 97 P +M +F+IP+ GSGIYVDLGG + V ++ R P G CPV GK I L Sbjct 96 PWIKYMQKFDIPRNHGSGIYVDLGGYESVGSKSYRMPVGKCPVVGKIIDL-------GNG 148 Query 98 NDFLDDIPTKQQS 110 DFLD I ++ S Sbjct 149 ADFLDPISSEDPS 161 > tpv:TP01_0650 apical membrane antigen 1; K13845 apical merozoite antigen 1 Length=785 Score = 49.7 bits (117), Expect = 2e-06, Method: Composition-based stats. Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 0/48 (0%) Query 40 SDFMDRFNIPKVLGSGIYVDLGGDKEVDGRTCREPSGLCPVFGKTIVL 87 ++FM +F+I KV GSG+YVDLG V R P G CPV GK I+L Sbjct 251 TEFMAKFDIAKVHGSGVYVDLGESATVGIYDYRMPIGKCPVVGKAIIL 298 > dre:100330606 RETRotransposon-like family member (retr-1)-like Length=722 Score = 32.3 bits (72), Expect = 0.41, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query 10 LVQIMCRRRRQPTDAALHQPNDNPFLVPPLSDFMDRFNIPKVLGS 54 L+ IMC+ R P L L L+DFM F IPKV+ S Sbjct 69 LLTIMCQTTRYPAAYPLRSITTKSIL-KALTDFMSIFGIPKVIQS 112 > dre:100333905 RETRotransposon-like family member (retr-1)-like Length=761 Score = 30.8 bits (68), Expect = 1.2, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query 7 TKQLVQIMCRRRRQPTDAALHQPNDNPFLVPPLSDFMDRFNIPKVLGS 54 +K L+ +MC+ R P AL +V LS F+ F IPKV+ S Sbjct 347 SKFLLTVMCQSTRYPAAYALRNITTRS-VVKALSQFISIFGIPKVIQS 393 > dre:100329991 LReO_3-like Length=1120 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query 10 LVQIMCRRRRQPTDAALHQPNDNPFLVPPLSDFMDRFNIPKVLGS 54 L+ +MC+ R PT L L L++FM F IPK + S Sbjct 386 LLTVMCQSTRYPTAYPLRSITTKSIL-KALTNFMSIFGIPKTIQS 429 > dre:100005980 LReO_3-like Length=1250 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query 10 LVQIMCRRRRQPTDAALHQPNDNPFLVPPLSDFMDRFNIPKVLGS 54 L+ +MC+ R PT L L L++FM F IPK + S Sbjct 502 LLTVMCQSTRYPTAYPLRSITTKSIL-KALTNFMSIFGIPKTIQS 545 > dre:100330549 RETRotransposon-like family member (retr-1)-like Length=1039 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query 10 LVQIMCRRRRQPTDAALHQPNDNPFLVPPLSDFMDRFNIPKVLGS 54 L+ +MC+ R PT L L L++FM F IPK + S Sbjct 388 LLTVMCQSTRYPTAYPLRSITTKSIL-KALTNFMSIFGIPKTIQS 431 > dre:100330758 RETRotransposon-like family member (retr-1)-like Length=549 Score = 29.6 bits (65), Expect = 2.5, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query 10 LVQIMCRRRRQPTDAALHQPNDNPFLVPPLSDFMDRFNIPKVLGS 54 L+ IMC+ P +L L L+DFM F IPKV+ S Sbjct 87 LLTIMCQTTHYPAAYSLRSITTKSIL-KALTDFMSIFGIPKVIQS 130 > ath:AT5G58970 ATUCP2; ATUCP2 (UNCOUPLING PROTEIN 2); oxidative phosphorylation uncoupler; K15103 solute carrier family 25 (mitochondrial uncoupling protein), member 8/9 Length=305 Score = 29.3 bits (64), Expect = 3.1, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 4/70 (5%) Query 47 NIPKVLGS-GIYVDLGGDKEVDGRTCREPSGL---CPVFGKTIVLYQPQNNPNYKNDFLD 102 N+PK GS G + ++ + G +GL C G I LY+P +DF+ Sbjct 53 NLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVGSDFIG 112 Query 103 DIPTKQQSDA 112 DIP Q+ A Sbjct 113 DIPLYQKILA 122 > cpv:cgd5_830 membrane associated protein with a transmembrane domain near C-terminus Length=901 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query 43 MDRFNIPKVLGS-GIYVDLGGDKEVD 67 +D+FN P+VLG +VD GDK D Sbjct 54 LDKFNFPEVLGKIKSFVDFNGDKFTD 79 > ath:AT4G19130 DNA binding / nucleic acid binding / zinc ion binding; K07466 replication factor A1 Length=784 Score = 28.5 bits (62), Expect = 6.2, Method: Compositional matrix adjust. Identities = 11/17 (64%), Positives = 14/17 (82%), Gaps = 0/17 (0%) Query 107 KQQSDAVGHPLPGGFNN 123 KQ SD +GHP+PGG +N Sbjct 106 KQISDIIGHPVPGGKHN 122 > hsa:729830 FAM160A1, FLJ43373; family with sequence similarity 160, member A1 Length=1040 Score = 28.1 bits (61), Expect = 6.6, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 7/61 (11%) Query 32 NPFLVPPLSDFMDRFNIPKVLGSGIYVDLGGDKEVDGRTCREPSGLCPVFGKTIVLYQPQ 91 N FLVP L+ + + + +V+ + Y+DL R+ EP+ L +F + I+L+Q + Sbjct 313 NGFLVPVLAPALHKVTVEEVMTTTAYLDLF------LRSISEPA-LLEIFLRFILLHQHE 365 Query 92 N 92 N Sbjct 366 N 366 > mmu:229473 D930015E06Rik, Kiaa0922, mKIAA0922; RIKEN cDNA D930015E06 gene Length=1597 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Query 74 PSGLCPVFGKTIVLYQPQNNPNYKNDFLDDIPTKQQSDAVGHPLPGGFN 122 PS CP+ + P+ N NY N F +K Q+D +GH P +N Sbjct 1444 PSVYCPLELNDYNAF-PEENMNYTNGF--PCSSKVQTDFIGHSTPSTWN 1489 > bbo:BBOV_III006150 17.m07545; ribosomal protein S9 Length=683 Score = 27.7 bits (60), Expect = 8.6, Method: Compositional matrix adjust. Identities = 20/61 (32%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Query 12 QIMCRRRRQPTDAA---LHQPNDNPFLVPPLSDFMDRFNIPKVLGSGIYVDLGGDKEVDG 68 Q+ RRRR P + DN L MD FNIPK VD+ + G Sbjct 191 QLKSRRRRLPQSFYGDDTYSSVDNEKLPEGCKSLMDFFNIPKNFDFKALVDVSTQSSLSG 250 Query 69 R 69 R Sbjct 251 R 251 Lambda K H 0.320 0.142 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2059772308 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40