bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2116_orf3 Length=95 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_090950 clathrin heavy chain, putative ; K04646 clat... 146 2e-35 xla:444287 cltc, MGC80936; clathrin, heavy chain (Hc); K04646 ... 78.6 4e-15 dre:503600 cltcb, im:7145213, zgc:113234; clathrin, heavy poly... 77.8 8e-15 mmu:67300 Cltc, 3110065L21Rik, CHC, MGC92975, R74732; clathrin... 77.4 9e-15 hsa:1213 CLTC, CHC, CHC17, CLH-17, CLTCL2, Hc, KIAA0034; clath... 77.4 9e-15 ath:AT3G08530 clathrin heavy chain, putative; K04646 clathrin ... 74.7 7e-14 ath:AT3G11130 clathrin heavy chain, putative; K04646 clathrin ... 74.7 7e-14 bbo:BBOV_IV001820 21.m02773; clathrin heavy chain; K04646 clat... 74.3 8e-14 tpv:TP03_0480 clathrin heavy chain; K04646 clathrin heavy chain 66.6 2e-11 sce:YGL206C CHC1, SWA5; Chc1p; K04646 clathrin heavy chain 64.3 9e-11 dre:323579 cltca, cb1033, cltc, wu:fc03e11, wu:fc49a11, wu:fd0... 63.5 1e-10 cel:T20G5.1 chc-1; Clathrin Heavy Chain family member (chc-1);... 61.2 9e-10 hsa:8218 CLTCL1, CHC22, CLH22, CLTCL, CLTD, FLJ36032; clathrin... 60.5 1e-09 cpv:cgd8_1270 clathrin heavy chain ; K04646 clathrin heavy chain 52.0 5e-07 pfa:PFL0930w clathrin heavy chain, putative; K04646 clathrin h... 49.3 3e-06 tgo:TGME49_015500 hypothetical protein 29.3 2.9 hsa:130162 C2orf63, FLJ31438; chromosome 2 open reading frame 63 29.3 sce:YLR045C STU2; Microtubule-associated protein (MAP) of the ... 28.5 6.0 dre:100148379 MGC113421, wu:fc49c05, wu:fi39c11; zgc:113421 28.1 7.3 mmu:73324 1700034F02Rik; RIKEN cDNA 1700034F02 gene 27.7 9.7 > tgo:TGME49_090950 clathrin heavy chain, putative ; K04646 clathrin heavy chain Length=1731 Score = 146 bits (368), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 70/95 (73%), Positives = 81/95 (85%), Gaps = 0/95 (0%) Query 1 LGPYMQHALPHLPNRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKS 60 L PY+ AL ++PNR QI SLAKRYGLPGA++TL+Q FNQHFASG+++ AARI ATLKS Sbjct 360 LIPYINQALVYVPNRQQIATSLAKRYGLPGAEETLMQEFNQHFASGNFKTAARIAATLKS 419 Query 61 GRLRTPQVLQQFKGVPAQPGQTSAILLYFSTLLEY 95 G LRT QV+QQFK VP QPGQTSAIL+YFSTLLEY Sbjct 420 GVLRTAQVIQQFKSVPTQPGQTSAILVYFSTLLEY 454 > xla:444287 cltc, MGC80936; clathrin, heavy chain (Hc); K04646 clathrin heavy chain Length=1675 Score = 78.6 bits (192), Expect = 4e-15, Method: Composition-based stats. Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 3/92 (3%) Query 6 QHALPHLPNRAQ---IYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGR 62 ++ +P++ N Q + L +A R L GA++ + FN FA G+Y AA++ A G Sbjct 332 ENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGI 391 Query 63 LRTPQVLQQFKGVPAQPGQTSAILLYFSTLLE 94 LRTP+ +++F+ VPAQPGQTS +L YF LL+ Sbjct 392 LRTPETIRRFQSVPAQPGQTSPLLQYFGILLD 423 > dre:503600 cltcb, im:7145213, zgc:113234; clathrin, heavy polypeptide b (Hc); K04646 clathrin heavy chain Length=1677 Score = 77.8 bits (190), Expect = 8e-15, Method: Composition-based stats. Identities = 38/92 (41%), Positives = 57/92 (61%), Gaps = 3/92 (3%) Query 6 QHALPHLPNRAQ---IYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGR 62 ++ +P++ N Q + L +A R L GA++ + FN FA G+Y AA++ A G Sbjct 332 ENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNNLFAGGNYSEAAKVAANAPKGI 391 Query 63 LRTPQVLQQFKGVPAQPGQTSAILLYFSTLLE 94 LRTP +++F+ VPAQPGQTS +L YF LL+ Sbjct 392 LRTPDTIRRFQSVPAQPGQTSPLLQYFGILLD 423 > mmu:67300 Cltc, 3110065L21Rik, CHC, MGC92975, R74732; clathrin, heavy polypeptide (Hc); K04646 clathrin heavy chain Length=1675 Score = 77.4 bits (189), Expect = 9e-15, Method: Composition-based stats. Identities = 38/92 (41%), Positives = 57/92 (61%), Gaps = 3/92 (3%) Query 6 QHALPHLPNRAQ---IYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGR 62 ++ +P++ N Q + L +A R L GA++ + FN FA G+Y AA++ A G Sbjct 332 ENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGI 391 Query 63 LRTPQVLQQFKGVPAQPGQTSAILLYFSTLLE 94 LRTP +++F+ VPAQPGQTS +L YF LL+ Sbjct 392 LRTPDTIRRFQSVPAQPGQTSPLLQYFGILLD 423 > hsa:1213 CLTC, CHC, CHC17, CLH-17, CLTCL2, Hc, KIAA0034; clathrin, heavy chain (Hc); K04646 clathrin heavy chain Length=1675 Score = 77.4 bits (189), Expect = 9e-15, Method: Composition-based stats. Identities = 38/92 (41%), Positives = 57/92 (61%), Gaps = 3/92 (3%) Query 6 QHALPHLPNRAQ---IYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGR 62 ++ +P++ N Q + L +A R L GA++ + FN FA G+Y AA++ A G Sbjct 332 ENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGI 391 Query 63 LRTPQVLQQFKGVPAQPGQTSAILLYFSTLLE 94 LRTP +++F+ VPAQPGQTS +L YF LL+ Sbjct 392 LRTPDTIRRFQSVPAQPGQTSPLLQYFGILLD 423 > ath:AT3G08530 clathrin heavy chain, putative; K04646 clathrin heavy chain Length=1703 Score = 74.7 bits (182), Expect = 7e-14, Method: Composition-based stats. Identities = 36/80 (45%), Positives = 50/80 (62%), Gaps = 0/80 (0%) Query 14 NRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFK 73 N ++ ++LAKR LPGA++ +VQ F + FA Y+ AA + A G LRTP + +F+ Sbjct 356 NNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQ 415 Query 74 GVPAQPGQTSAILLYFSTLL 93 VP Q GQT +L YF TLL Sbjct 416 SVPVQAGQTPPLLQYFGTLL 435 > ath:AT3G11130 clathrin heavy chain, putative; K04646 clathrin heavy chain Length=1705 Score = 74.7 bits (182), Expect = 7e-14, Method: Composition-based stats. Identities = 36/80 (45%), Positives = 50/80 (62%), Gaps = 0/80 (0%) Query 14 NRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFK 73 N ++ ++LAKR LPGA++ +VQ F + FA Y+ AA + A G LRTP + +F+ Sbjct 356 NNLELAVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQ 415 Query 74 GVPAQPGQTSAILLYFSTLL 93 VP Q GQT +L YF TLL Sbjct 416 SVPVQAGQTPPLLQYFGTLL 435 > bbo:BBOV_IV001820 21.m02773; clathrin heavy chain; K04646 clathrin heavy chain Length=1676 Score = 74.3 bits (181), Expect = 8e-14, Method: Composition-based stats. Identities = 31/79 (39%), Positives = 55/79 (69%), Gaps = 0/79 (0%) Query 17 QIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFKGVP 76 ++ +SLA R+G PG++ ++++F ++F+ +Y+ AA + ATLK+G LRT + +++F P Sbjct 356 EVRISLATRFGYPGSESLMMRSFEEYFSRREYKQAALLVATLKNGALRTNETMERFLNAP 415 Query 77 AQPGQTSAILLYFSTLLEY 95 G+TS L YFS +LE+ Sbjct 416 VLAGETSPALHYFSVMLEH 434 > tpv:TP03_0480 clathrin heavy chain; K04646 clathrin heavy chain Length=1696 Score = 66.6 bits (161), Expect = 2e-11, Method: Composition-based stats. Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 2/81 (2%) Query 14 NRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFK 73 N ++ + +A YGL G+DD L+++F F + YR AA+I ATLKS +LRT +Q+FK Sbjct 371 NLKEVSVGIATCYGLKGSDDLLLESFESFFNNEQYRQAAQIVATLKSNQLRTLDTIQRFK 430 Query 74 GVPAQPGQTSAILLYFSTLLE 94 + G +A+ YFS LLE Sbjct 431 NKTTETG--NALSHYFSVLLE 449 > sce:YGL206C CHC1, SWA5; Chc1p; K04646 clathrin heavy chain Length=1653 Score = 64.3 bits (155), Expect = 9e-11, Method: Composition-based stats. Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 6/92 (6%) Query 3 PYMQHALPHLPNRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGR 62 PY+ + L ++ + L +A R GLPGADD + F DY+ AA++ A+ S Sbjct 342 PYILNKLSNVA----LALIVATRGGLPGADDLFQKQFESLLLQNDYQNAAKVAAS--STS 395 Query 63 LRTPQVLQQFKGVPAQPGQTSAILLYFSTLLE 94 LR + + K + A PG S ILLYFSTLL+ Sbjct 396 LRNQNTINRLKNIQAPPGAISPILLYFSTLLD 427 > dre:323579 cltca, cb1033, cltc, wu:fc03e11, wu:fc49a11, wu:fd07f02; clathrin, heavy polypeptide a (Hc); K04646 clathrin heavy chain Length=1680 Score = 63.5 bits (153), Expect = 1e-10, Method: Composition-based stats. Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 0/75 (0%) Query 20 LSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFKGVPAQP 79 L +A R L GA++ + FN FA G++ AA++ A G LRTP +++F+ VPAQP Sbjct 349 LRMAVRNNLAGAEELFGRKFNNLFAGGNFAEAAKVAANAPKGILRTPDTIRRFQSVPAQP 408 Query 80 GQTSAILLYFSTLLE 94 GQTS +L YF LL+ Sbjct 409 GQTSPLLQYFGILLD 423 > cel:T20G5.1 chc-1; Clathrin Heavy Chain family member (chc-1); K04646 clathrin heavy chain Length=1681 Score = 61.2 bits (147), Expect = 9e-10, Method: Composition-based stats. Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Query 9 LPHLPNRAQ---IYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRT 65 +P + N+ Q + L LA R LPGA++ V+ FN F++G + +A++ A+ G LRT Sbjct 333 VPFVTNQLQNPDLALKLAVRCDLPGAEELFVRKFNLLFSNGQFGESAKVAASAPQGILRT 392 Query 66 PQVLQQFKGVPAQPGQTSAILLYFSTLLE 94 P +Q+F+ P+ S +L YF LL+ Sbjct 393 PATIQKFQQCPSTGPGPSPLLQYFGILLD 421 > hsa:8218 CLTCL1, CHC22, CLH22, CLTCL, CLTD, FLJ36032; clathrin, heavy chain-like 1; K04646 clathrin heavy chain Length=1583 Score = 60.5 bits (145), Expect = 1e-09, Method: Composition-based stats. Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 0/75 (0%) Query 20 LSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFKGVPAQP 79 L LA R L GA+ V+ FN FA G Y AA++ A+ G LRT + +Q+F+ +PAQ Sbjct 349 LRLAVRSNLAGAEKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQS 408 Query 80 GQTSAILLYFSTLLE 94 GQ S +L YF LL+ Sbjct 409 GQASPLLQYFGILLD 423 > cpv:cgd8_1270 clathrin heavy chain ; K04646 clathrin heavy chain Length=2007 Score = 52.0 bits (123), Expect = 5e-07, Method: Composition-based stats. Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Query 20 LSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFKGVPAQP 79 L +RYG G D+ ++ FN+ DY+ A R+ + K+G LRTP L FK V + Sbjct 386 LRWTQRYGYQGTDEFSIRMFNESIKRQDYQNACRVVSLNKNGSLRTPATLNHFKMVDS-- 443 Query 80 GQTSAILLYFSTLLEY 95 + YF+T+ ++ Sbjct 444 -SNKLLFQYFTTVFKF 458 > pfa:PFL0930w clathrin heavy chain, putative; K04646 clathrin heavy chain Length=1997 Score = 49.3 bits (116), Expect = 3e-06, Method: Composition-based stats. Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 30/115 (26%) Query 9 LPHLPNRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAARICATLKSGR------ 62 L +L + +I +L +YG PG D + A+ + D++ A++I +K+ + Sbjct 378 LSNLEFKDKIIKNLCVKYGYPGCD--YISAYKKCINDMDFKKASKIICLMKNTKIFEEHS 435 Query 63 ----------------------LRTPQVLQQFKGVPAQPGQTSAILLYFSTLLEY 95 LRT QVL FK GQ S +LLYFS LLEY Sbjct 436 NNIAESILIMNRKNIDIRIIPPLRTQQVLNSFKSFKNTSGQLSPLLLYFSVLLEY 490 > tgo:TGME49_015500 hypothetical protein Length=574 Score = 29.3 bits (64), Expect = 2.9, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 0/43 (0%) Query 9 LPHLPNRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGA 51 L HL N+AQ L L K A T++Q ++H A YR A Sbjct 257 LTHLRNQAQTALKLEKFQEAIKACTTIIQDIDEHDAKARYRRA 299 > hsa:130162 C2orf63, FLJ31438; chromosome 2 open reading frame 63 Length=464 Score = 29.3 bits (64), Expect = 3.0, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 0/58 (0%) Query 36 VQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFKGVPAQPGQTSAILLYFSTLL 93 ++ FN+ + G+Y AA A LR + FK V G+ +LL+F L Sbjct 176 IERFNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALF 233 > sce:YLR045C STU2; Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p Length=888 Score = 28.5 bits (62), Expect = 6.0, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Query 9 LPHLPNRAQIYLSLAKRYGLPGADDTLVQAFNQHFASGD-YRGAARICATLKS 60 LPH N I G+ D L FN FAS + Y+ AA + +TLK+ Sbjct 819 LPHRVNSLNIRPYRKNGTGVSSVSDDLDIDFNDSFASEESYKRAAAVTSTLKA 871 > dre:100148379 MGC113421, wu:fc49c05, wu:fi39c11; zgc:113421 Length=1912 Score = 28.1 bits (61), Expect = 7.3, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 8/55 (14%) Query 10 PHLPNR-----AQIYLSLAKRYGLPGADDTLVQAFNQHFASGDYRGAAR---ICA 56 PH+PN+ A Y LAK + ++ F Q ASG ++G R +CA Sbjct 1304 PHVPNQPSEAAAHFYFELAKTVLIKAGGNSSTSIFTQPSASGGHQGPHRNLHLCA 1358 > mmu:73324 1700034F02Rik; RIKEN cDNA 1700034F02 gene Length=585 Score = 27.7 bits (60), Expect = 9.7, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 26/58 (44%), Gaps = 0/58 (0%) Query 36 VQAFNQHFASGDYRGAARICATLKSGRLRTPQVLQQFKGVPAQPGQTSAILLYFSTLL 93 ++ FN + G+Y AA A L+ + +FK + G+ +LL+F + Sbjct 298 IERFNDLISLGEYERAACFAANSPKRILQNTSTMNKFKAIGKIRGKPLPLLLFFEAIF 355 Lambda K H 0.323 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2065224908 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40