bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2303_orf2 Length=60 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_016880 receptor for activated C kinase, RACK protei... 105 3e-23 pfa:PF08_0019 PfRACK; receptor for activated C kinase homolog,... 94.0 1e-19 dre:30722 gnb2l1, rack1, wu:fb80d08, wu:fk65d12; guanine nucle... 91.7 5e-19 xla:495666 gnb2l1, gnb2-rs1, h12.3, hlc-7, pig21, rack1; guani... 90.1 2e-18 mmu:14694 Gnb2l1, AL033335, GB-like, Gnb2-rs1, Rack1, p205; gu... 90.1 2e-18 hsa:10399 GNB2L1, Gnb2-rs1, H12.3, HLC-7, PIG21, RACK1; guanin... 90.1 2e-18 xla:446289 MGC130692; hypothetical protein LOC446289; K00567 m... 89.7 2e-18 xla:379825 gnb2l1, MGC53289; guanine nucleotide binding protei... 89.7 2e-18 cpv:cgd2_1870 guanine nucleotide-binding protein ; K14753 guan... 88.2 7e-18 tpv:TP04_0288 guanine nucleotide-binding protein; K14753 guani... 84.7 6e-17 cel:K04D7.1 rack-1; RACK1 (mammalian Receptor of Activated C K... 84.0 1e-16 ath:AT1G18080 ATARCA; ATARCA; nucleotide binding; K14753 guani... 77.0 1e-14 ath:AT3G18130 RACK1C_AT (RECEPTOR FOR ACTIVATED C KINASE 1 C);... 74.7 7e-14 bbo:BBOV_II003050 18.m06254; receptor for activated C kinase, ... 71.6 6e-13 ath:AT1G48630 RACK1B_AT (RECEPTOR FOR ACTIVATED C KINASE 1 B);... 70.9 1e-12 xla:734519 poc1b, MGC114911, pix1, tuwd12, wdr51b; POC1 centri... 47.4 1e-05 sce:YMR116C ASC1, CPC2; Asc1p; K14753 guanine nucleotide-bindi... 44.7 8e-05 hsa:282809 POC1B, FLJ14923, FLJ41111, PIX1, TUWD12, WDR51B; PO... 44.3 1e-04 mmu:382406 Poc1b, 4933430F16Rik, Wdr51b; POC1 centriolar prote... 44.3 1e-04 dre:541405 pex7, zgc:103552; peroxisomal biogenesis factor 7; ... 43.5 2e-04 dre:386932 poc1b, TUWD12, fl36w17, wdr51b, wu:fl36w17, zgc:635... 43.5 2e-04 xla:379573 poc1a, MGC69111, pix2, wdr51a; POC1 centriolar prot... 41.2 8e-04 cpv:cgd7_5010 coatomer complex beta 40.8 0.001 mmu:70235 Poc1a, 2510040D07Rik, Wdr51a; POC1 centriolar protei... 40.4 0.002 ath:AT3G16830 TPR2; TPR2 (TOPLESS-RELATED 2) 40.4 0.002 mmu:74187 Katnb1, 2410003J24Rik, KAT; katanin p80 (WD40-contai... 40.0 0.002 hsa:10300 KATNB1, KAT; katanin p80 (WD repeat containing) subu... 40.0 0.002 ath:AT5G23430 transducin family protein / WD-40 repeat family ... 40.0 0.002 dre:406291 katnb1, wu:fj32f02, wu:fj65h01, zgc:56071; katanin ... 38.5 0.005 ath:AT5G08390 hypothetical protein 38.5 0.005 ath:AT1G47610 transducin family protein / WD-40 repeat family ... 38.5 0.006 hsa:25886 POC1A, DKFZp434C245, MGC131902, PIX2, WDR51A; POC1 c... 38.5 0.006 cel:T02H6.1 hypothetical protein; K14793 ribosomal RNA-process... 38.1 0.006 hsa:5191 PEX7, PTS2R, RCDP1, RD; peroxisomal biogenesis factor... 38.1 0.006 dre:406322 poc1a, wdr51a, wu:fl82d01, zgc:56055; POC1 centriol... 38.1 0.006 sce:YDL145C COP1, RET1, SEC33, SOO1; Alpha subunit of COPI ves... 38.1 0.007 xla:380367 nle1, MGC52549, nle; notchless homolog 1; K14855 ri... 38.1 0.007 dre:100004402 plrg1, MGC174842, MGC55651, MGC86603, wu:fi74f01... 37.7 0.008 tgo:TGME49_040650 coatomer alpha subunit, putative (EC:2.7.11.... 37.7 0.008 tpv:TP04_0666 hypothetical protein; K12862 pleiotropic regulat... 37.7 0.010 xla:398057 paaf1, paaf, rpn14, wdr71; proteasomal ATPase-assoc... 37.4 0.012 xla:495399 plrg1; pleiotropic regulator 1 (PRL1 homolog); K128... 37.4 0.013 tpv:TP04_0117 zinc finger protein 37.4 0.013 xla:495006 hypothetical LOC495006 37.0 0.014 hsa:5356 PLRG1, MGC110980, PRL1, PRP46, PRPF46; pleiotropic re... 37.0 0.014 mmu:53317 Plrg1, AA958940, C80566; pleiotropic regulator 1, PR... 37.0 0.015 pfa:PFC0100c regulatory protein, putative; K12862 pleiotropic ... 37.0 0.016 sce:YPR178W PRP4, RNA4; Prp4p; K12662 U4/U6 small nuclear ribo... 37.0 0.017 cel:D1054.15 tag-135; Temporarily Assigned Gene name family me... 36.6 0.018 xla:444261 apaf1, MGC80868, apaf-1; apoptotic peptidase activa... 36.6 0.019 > tgo:TGME49_016880 receptor for activated C kinase, RACK protein, putative (EC:2.7.11.7); K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=321 Score = 105 bits (263), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 49/60 (81%), Positives = 54/60 (90%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YTI + QH DWVSCVRFSPS +PLIVSCGWDKLVKVW+L++CKL TNLVGHTSVLYTVT Sbjct 145 YTIVDDQHNDWVSCVRFSPSANKPLIVSCGWDKLVKVWNLSNCKLRTNLVGHTSVLYTVT 204 > pfa:PF08_0019 PfRACK; receptor for activated C kinase homolog, PfRACK; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=323 Score = 94.0 bits (232), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 42/60 (70%), Positives = 49/60 (81%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YTI + QHTDW++CVRFSPSP + +IVSCGWDKLVKVW+L +C L NL GHT VL TVT Sbjct 149 YTITDQQHTDWITCVRFSPSPNQAIIVSCGWDKLVKVWNLKNCDLNKNLEGHTGVLNTVT 208 Score = 33.1 bits (74), Expect = 0.23, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Query 5 EGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLT----SCKLIT---NLVGHTSVLY 57 EG H+DWV+ V PK IVS DK + VW++ S ++ T +L GH+ + Sbjct 17 EGGHSDWVTSVSTPTDPKLKTIVSASRDKKLIVWNINTDDDSGEIGTAKKSLTGHSQAIN 76 Query 58 TVT 60 V+ Sbjct 77 DVS 79 Score = 30.4 bits (67), Expect = 1.6, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 25 LIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 +S WD V++W L+ + I + +GHTS +++V+ Sbjct 86 FALSGSWDHSVRLWDLSLGETIRSFIGHTSDVFSVS 121 > dre:30722 gnb2l1, rack1, wu:fb80d08, wu:fk65d12; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=317 Score = 91.7 bits (226), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 40/60 (66%), Positives = 49/60 (81%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YTI++ HT+WVSCVRFSP+ P+IVSCGWDK+VKVW+L +CKL TN +GHT L TVT Sbjct 140 YTIQDDSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVT 199 Score = 27.7 bits (60), Expect = 8.6, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ +VS V S + +S WD +++W LT+ VGHT + +V Sbjct 62 HSHFVSDVVISSDGQ--FALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSV 111 > xla:495666 gnb2l1, gnb2-rs1, h12.3, hlc-7, pig21, rack1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=317 Score = 90.1 bits (222), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 39/60 (65%), Positives = 49/60 (81%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YT+++ H++WVSCVRFSP+ P+IVSCGWDKLVKVW+L +CKL TN +GHT L TVT Sbjct 140 YTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVT 199 Score = 27.7 bits (60), Expect = 9.0, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ +VS V S + +S WD +++W LT+ VGHT + +V Sbjct 62 HSHFVSDVVISSDGQ--FALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSV 111 > mmu:14694 Gnb2l1, AL033335, GB-like, Gnb2-rs1, Rack1, p205; guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=317 Score = 90.1 bits (222), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 39/60 (65%), Positives = 49/60 (81%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YT+++ H++WVSCVRFSP+ P+IVSCGWDKLVKVW+L +CKL TN +GHT L TVT Sbjct 140 YTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVT 199 Score = 27.7 bits (60), Expect = 9.0, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ +VS V S + +S WD +++W LT+ VGHT + +V Sbjct 62 HSHFVSDVVISSDGQ--FALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSV 111 > hsa:10399 GNB2L1, Gnb2-rs1, H12.3, HLC-7, PIG21, RACK1; guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=317 Score = 90.1 bits (222), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 39/60 (65%), Positives = 49/60 (81%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YT+++ H++WVSCVRFSP+ P+IVSCGWDKLVKVW+L +CKL TN +GHT L TVT Sbjct 140 YTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVT 199 Score = 27.7 bits (60), Expect = 9.0, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ +VS V S + +S WD +++W LT+ VGHT + +V Sbjct 62 HSHFVSDVVISSDGQ--FALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSV 111 > xla:446289 MGC130692; hypothetical protein LOC446289; K00567 methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63] Length=317 Score = 89.7 bits (221), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 38/60 (63%), Positives = 49/60 (81%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YT++E H++WVSCVRFSP+ P+IVSCGWDK+VKVW+L +CKL TN +GH+ L TVT Sbjct 140 YTVQEESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHSGYLNTVT 199 Score = 27.7 bits (60), Expect = 9.4, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ +VS V S + +S WD +++W LT+ VGHT + +V Sbjct 62 HSHFVSDVVISSDGQ--FALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSV 111 > xla:379825 gnb2l1, MGC53289; guanine nucleotide binding protein, beta 2, related sequence 1; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=317 Score = 89.7 bits (221), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 38/60 (63%), Positives = 49/60 (81%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YT++E H++WVSCVRFSP+ P+IVSCGWDK+VKVW+L +CKL TN +GH+ L TVT Sbjct 140 YTVQEESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHSGYLNTVT 199 Score = 27.7 bits (60), Expect = 9.4, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ +VS V S + +S WD +++W LT+ VGHT + +V Sbjct 62 HSHFVSDVVISSDGQ--FALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSV 111 > cpv:cgd2_1870 guanine nucleotide-binding protein ; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=313 Score = 88.2 bits (217), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 43/60 (71%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YT+ +GQH DWVSCVRFSPS +PL VSCGWDK+VKVWS K NLVGH+SVLYTVT Sbjct 143 YTLLDGQHNDWVSCVRFSPSTSQPLFVSCGWDKIVKVWS-HEFKPTCNLVGHSSVLYTVT 201 Score = 28.5 bits (62), Expect = 5.0, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 26 IVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 +VS DK ++++ + + K + N VGHTS +++V Sbjct 81 VVSGSCDKTLRLFDVNAGKSVRNFVGHTSDVFSVA 115 Score = 28.5 bits (62), Expect = 5.6, Method: Compositional matrix adjust. Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 9/61 (14%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCK--------LITNLVGHTSVLYTV 59 H+DWV+ + +P ++VS DK V VW+L+ T L GH + V Sbjct 14 HSDWVTSIA-APPDNSDIVVSASRDKSVLVWNLSDANKDQHSIGSAKTRLTGHNQAVNDV 72 Query 60 T 60 Sbjct 73 A 73 > tpv:TP04_0288 guanine nucleotide-binding protein; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=331 Score = 84.7 bits (208), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YTI HTDWVSCVRFSPS KEP+ VS GWDKL+KVW L +C+L L GH V+Y+V+ Sbjct 153 YTITNSTHTDWVSCVRFSPSGKEPIFVSGGWDKLIKVWDLRTCQLKHTLYGHEGVVYSVS 212 Score = 28.1 bits (61), Expect = 7.0, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWS-LTSCKL-ITN 48 HT V+ V FSP ++ I+S DK +K+W+ L CK ITN Sbjct 117 HTKDVNSVAFSPDNRQ--IISGSRDKTIKLWNTLAECKYTITN 157 > cel:K04D7.1 rack-1; RACK1 (mammalian Receptor of Activated C Kinase) homolog family member (rack-1); K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=325 Score = 84.0 bits (206), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 38/60 (63%), Positives = 48/60 (80%), Gaps = 0/60 (0%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 YTI + HTDWVS VRFSPS ++P+IVS GWDK+VKVW+L +C+L TN +GHT + TVT Sbjct 146 YTITDDCHTDWVSTVRFSPSNRDPVIVSAGWDKVVKVWNLGNCRLKTNHIGHTGYVNTVT 205 > ath:AT1G18080 ATARCA; ATARCA; nucleotide binding; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=327 Score = 77.0 bits (188), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 37/62 (59%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Query 1 YTIEEGQ--HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYT 58 YTI EG H DWVSCVRFSP+ +P IVS WDK VKVW+L++CKL + L GHT + T Sbjct 140 YTISEGGEGHRDWVSCVRFSPNTLQPTIVSASWDKTVKVWNLSNCKLRSTLAGHTGYVST 199 Query 59 VT 60 V Sbjct 200 VA 201 > ath:AT3G18130 RACK1C_AT (RECEPTOR FOR ACTIVATED C KINASE 1 C); nucleotide binding; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=326 Score = 74.7 bits (182), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 37/61 (60%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Query 1 YTIEEGQ-HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 YTI EG H +WVSCVRFSP+ P IVS WDK VKVW+L +CKL +LVGH+ L TV Sbjct 140 YTISEGDGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNSLVGHSGYLNTV 199 Query 60 T 60 Sbjct 200 A 200 > bbo:BBOV_II003050 18.m06254; receptor for activated C kinase, RACK protein; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=322 Score = 71.6 bits (174), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 0/52 (0%) Query 5 EGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVL 56 + H DWVSCVRFSP+P E + VS GWDK+VKVW L +C L NL GH ++ Sbjct 148 QNAHNDWVSCVRFSPNPHEHVFVSGGWDKIVKVWDLANCNLKFNLSGHEGIV 199 Score = 31.2 bits (69), Expect = 0.75, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 25 LIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 +S WD +++W L CK + GHTS +Y+V Sbjct 82 FALSGSWDNTLRLWDLVKCKTVHVYNGHTSDVYSV 116 > ath:AT1G48630 RACK1B_AT (RECEPTOR FOR ACTIVATED C KINASE 1 B); nucleotide binding; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=326 Score = 70.9 bits (172), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 35/61 (57%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Query 1 YTIEEGQ-HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 YTI E H +WVSCVRFSP+ P IVS WDK VKVW+L +CKL L GH+ L TV Sbjct 140 YTISEADGHKEWVSCVRFSPNTLVPTIVSASWDKTVKVWNLQNCKLRNTLAGHSGYLNTV 199 Query 60 T 60 Sbjct 200 A 200 > xla:734519 poc1b, MGC114911, pix1, tuwd12, wdr51b; POC1 centriolar protein homolog B (Chlamydomonas) Length=468 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 5/51 (9%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLV---GHTS 54 QHT+WV C RFSP + LI SC DK V++W LT+ I V GH++ Sbjct 142 QHTNWVRCARFSPDGR--LIASCSDDKTVRIWDLTNRLCINTFVDYKGHSN 190 Score = 32.3 bits (72), Expect = 0.38, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H + V+CV+FSPS L+ S D+ V++W+ T L HT+V+ V Sbjct 59 HKEAVTCVQFSPSGH--LVASSSKDRTVRLWAPNIKGESTVLKAHTAVVRCVN 109 Score = 29.3 bits (64), Expect = 3.3, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVL 56 H D V+CV FSP K+ + S D V +W+ GH + Sbjct 17 HKDAVTCVDFSPDSKQ--LASSSADACVMIWNFKPQSRAYKYPGHKEAV 63 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTS 54 HT V CV FS + ++ DK +K W+L + + +L HT+ Sbjct 101 HTAVVRCVNFSSDGQ--TFITASDDKSIKAWNLHRQRFLFSLTQHTN 145 > sce:YMR116C ASC1, CPC2; Asc1p; K14753 guanine nucleotide-binding protein subunit beta-2-like 1 protein Length=319 Score = 44.7 bits (104), Expect = 8e-05, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 4/57 (7%) Query 8 HTDWVSCVRFSPSPKEP----LIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H DWVS VR P+ K I+S G DK+VK W+L ++ + +GH S + T+T Sbjct 147 HNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLT 203 > hsa:282809 POC1B, FLJ14923, FLJ41111, PIX1, TUWD12, WDR51B; POC1 centriolar protein homolog B (Chlamydomonas) Length=436 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNL 49 +HT WV C +FSP + LIVSC DK +K+W T+ + + N Sbjct 100 RHTHWVRCAKFSPDGR--LIVSCSEDKTIKIWDTTNKQCVNNF 140 Score = 34.3 bits (77), Expect = 0.10, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H+ V+C+ F PS +++ D +K+ L +LI L GHT ++TV+ Sbjct 185 HSGGVNCISFHPSGN--YLITASSDGTLKILDLLEGRLIYTLQGHTGPVFTVS 235 > mmu:382406 Poc1b, 4933430F16Rik, Wdr51b; POC1 centriolar protein homolog B (Chlamydomonas) Length=476 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNL 49 +HT WV C +FSP + LIVSC DK +K+W T+ + + N Sbjct 142 RHTHWVRCAKFSPDGR--LIVSCSEDKTIKIWDTTNKQCVNNF 182 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H+ V+C+ F P +V+ D VK+ L +LI L GHT ++TV+ Sbjct 227 HSCGVNCLSFHPLGNS--LVTASSDGTVKMLDLIEGRLIYTLQGHTGPVFTVS 277 Score = 29.6 bits (65), Expect = 2.4, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Query 4 EEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHT 53 E HT V V FS + L+V+ DK +KVWS+ + + +L HT Sbjct 97 EFKAHTAPVRSVDFSADGQ--LLVTASEDKSIKVWSMFRQRFLYSLYRHT 144 Score = 29.3 bits (64), Expect = 3.2, Method: Compositional matrix adjust. Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H ++ FSP+ K+ I + WD + +WSL VGH V+ ++ Sbjct 17 HKAAITSADFSPNCKQ--IATASWDTFLMLWSLKPHARAYRYVGHKDVVTSL 66 > dre:541405 pex7, zgc:103552; peroxisomal biogenesis factor 7; K13341 peroxin-7 Length=314 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 0/51 (0%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYT 58 HT V V +S + E L+VS WD KVW C+L+ +L GH V+Y+ Sbjct 102 HTQEVYSVDWSQTRAENLLVSGSWDHTAKVWDPVQCQLVNSLQGHEGVIYS 152 > dre:386932 poc1b, TUWD12, fl36w17, wdr51b, wu:fl36w17, zgc:63538; POC1 centriolar protein homolog B (Chlamydomonas) Length=490 Score = 43.5 bits (101), Expect = 2e-04, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTS 42 +HT+WV C RFSP + LI SCG D+ V++W +S Sbjct 142 RHTNWVRCARFSPDGR--LIASCGDDRTVRLWDTSS 175 Score = 35.4 bits (80), Expect = 0.049, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H D +SC F+P+ K+ SC DK + +W+L VGHT V+ V Sbjct 17 HKDVISCADFNPNNKQLATGSC--DKSLMIWNLAPKARAFRFVGHTDVITGV 66 Score = 29.6 bits (65), Expect = 2.8, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H V+C F PS ++S D +K+ L +LI L GH + TVT Sbjct 227 HNAGVNCFSFHPSGN--YLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVT 277 > xla:379573 poc1a, MGC69111, pix2, wdr51a; POC1 centriolar protein homolog A (Chlamydomonas) Length=399 Score = 41.2 bits (95), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGH 52 QH +WV C +FSP + LIVS DK +K+W TS + I + H Sbjct 100 QHINWVRCAKFSPDGR--LIVSASDDKTIKLWDKTSRECIQSFCEH 143 Score = 29.6 bits (65), Expect = 2.7, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 +H +V+ V F PS I + D VKVW + KLI + H+ V+ +++ Sbjct 142 EHGGFVNFVDFHPSGT--CIAAAATDNTVKVWDIRMNKLIQHYQVHSGVVNSLS 193 > cpv:cgd7_5010 coatomer complex beta Length=1157 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 0/52 (0%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H ++C+ +SPS ++P I + DK V+VW + + I L GHT + +V Sbjct 198 HEGGINCLAYSPSAEKPYIATGSDDKTVRVWDYQTKQCIQVLTGHTKAVRSV 249 > mmu:70235 Poc1a, 2510040D07Rik, Wdr51a; POC1 centriolar protein homolog A (Chlamydomonas) Length=405 Score = 40.4 bits (93), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGH 52 QH +WV C +FSP + LIVS DK VK+W TS + I + H Sbjct 143 QHINWVRCAKFSPDGR--LIVSASDDKTVKLWDKTSRECIHSYCEH 186 Score = 32.0 bits (71), Expect = 0.45, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H D V+CV FSPS L+ S DK V++W T HT+ + +V Sbjct 60 HKDAVTCVNFSPSGH--LLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSV 109 > ath:AT3G16830 TPR2; TPR2 (TOPLESS-RELATED 2) Length=1131 Score = 40.4 bits (93), Expect = 0.002, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query 3 IEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 +E H V+ + F+ K+ +V+CG DKL+KVW L+ KL T GH + +Y++ Sbjct 447 LEIDAHVGCVNDLAFAHPNKQMCVVTCGDDKLIKVWDLSGKKLFT-FEGHEAPVYSI 502 > mmu:74187 Katnb1, 2410003J24Rik, KAT; katanin p80 (WD40-containing) subunit B 1 Length=658 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ V C+RFSP K + S D VK+W LT+ K+++ GHT + V Sbjct 146 HSQAVRCLRFSPDGK--WLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVV 195 Score = 32.0 bits (71), Expect = 0.54, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTS 54 HT V VR + +P+E LIV+ ++VW L + K++ L+GH + Sbjct 62 HTSPVESVRLN-TPEE-LIVAGSQSGSIRVWDLEAAKILRTLMGHKA 106 > hsa:10300 KATNB1, KAT; katanin p80 (WD repeat containing) subunit B 1 Length=655 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ V C+RFSP K + S D VK+W LT+ K+++ GHT + V Sbjct 146 HSQAVRCLRFSPDGK--WLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVV 195 Score = 32.0 bits (71), Expect = 0.55, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTS 54 HT V VR + +P+E LIV+ ++VW L + K++ L+GH + Sbjct 62 HTSPVESVRLN-TPEE-LIVAGSQSGSIRVWDLEAAKILRTLMGHKA 106 > ath:AT5G23430 transducin family protein / WD-40 repeat family protein Length=836 Score = 40.0 bits (92), Expect = 0.002, Method: Composition-based stats. Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGH 52 HT V+ +RF+P + +VS G D +VKVW LT+ KL+T H Sbjct 142 HTRGVNVLRFTPDGR--WVVSGGEDNIVKVWDLTAGKLLTEFKSH 184 Score = 28.1 bits (61), Expect = 7.2, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTS 54 H+ + V F S E L+ + +K+W L K++ L GH S Sbjct 58 HSSGIDSVTFDAS--EVLVAAGAASGTIKLWDLEEAKIVRTLTGHRS 102 Score = 28.1 bits (61), Expect = 7.3, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H+ V+C++ ++V+ G D V +W++ I +L GH+S + +VT Sbjct 15 HSAAVNCLKIGRKSSR-VLVTGGEDHKVNLWAIGKPNAILSLYGHSSGIDSVT 66 > dre:406291 katnb1, wu:fj32f02, wu:fj65h01, zgc:56071; katanin p80 (WD repeat containing) subunit B 1 Length=694 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 HT V C+ FSP K + S D VK+W L + K+IT HTS + V Sbjct 146 HTQAVRCLAFSPDGK--WLASASDDSTVKLWDLIAGKMITEFTSHTSAVNVV 195 Score = 34.3 bits (77), Expect = 0.11, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 HT V+ V+F P+ E L+ S D+ VK+W L +I + G T V+ +V Sbjct 188 HTSAVNVVQFHPN--EYLLASGSADRTVKLWDLEKFNMIGSSEGETGVVRSV 237 Score = 32.3 bits (72), Expect = 0.34, Method: Compositional matrix adjust. Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 HT V C++F+ S E +V+ +++W L + K++ L+GH + + ++ Sbjct 62 HTSAVGCIQFNSS--EERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSL 111 > ath:AT5G08390 hypothetical protein Length=839 Score = 38.5 bits (88), Expect = 0.005, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 HT V+ +RF+P + IVS G D +VKVW LT+ KL+ H + ++ Sbjct 142 HTRGVNVLRFTPDGR--WIVSGGEDNVVKVWDLTAGKLLHEFKSHEGKIQSL 191 Score = 29.3 bits (64), Expect = 3.4, Method: Compositional matrix adjust. Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTS 54 H+ + V F S E L+ + +K+W L K++ L GH S Sbjct 58 HSSGIDSVTFDAS--EGLVAAGAASGTIKLWDLEEAKVVRTLTGHRS 102 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H+ V+C++ ++V+ G D V +W++ I +L GH+S + +VT Sbjct 15 HSAAVNCLKIGRKSSR-VLVTGGEDHKVNLWAIGKPNAILSLYGHSSGIDSVT 66 > ath:AT1G47610 transducin family protein / WD-40 repeat family protein Length=351 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 +H+D VSC S + + L+ S WD+ VKVW + K I ++ H + +VT Sbjct 133 KHSDAVSC--LSLAEDQGLLYSASWDRTVKVWRIHDLKCIESIKAHDDAVNSVT 184 > hsa:25886 POC1A, DKFZp434C245, MGC131902, PIX2, WDR51A; POC1 centriolar protein homolog A (Chlamydomonas) Length=359 Score = 38.5 bits (88), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGH 52 QH +WV C +FSP + LIVS DK VK+W +S + + + H Sbjct 143 QHINWVRCAKFSPDGR--LIVSASDDKTVKLWDKSSRECVHSYCEH 186 Score = 31.6 bits (70), Expect = 0.60, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 9/53 (16%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H D V+CV FSPS L+ S DK V++W + N+ G ++V T Sbjct 60 HKDAVTCVNFSPSGH--LLASGSRDKTVRIW-------VPNVKGESTVFRAHT 103 Score = 28.9 bits (63), Expect = 4.3, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVL 56 +H +V+ V F PS I + G D VKVW + + +L+ + H++ + Sbjct 185 EHGGFVTYVDFHPSGT--CIAAAGMDNTVKVWDVRTHRLLQHYQLHSAAV 232 > cel:T02H6.1 hypothetical protein; K14793 ribosomal RNA-processing protein 9 Length=540 Score = 38.1 bits (87), Expect = 0.006, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 0/41 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 SP + I S G+D++VK+W+ S + I +L GH ++++T Sbjct 205 SPDQKFIASGGFDQVVKIWNFDSLEHIKDLSGHRGPIFSLT 245 > hsa:5191 PEX7, PTS2R, RCDP1, RD; peroxisomal biogenesis factor 7; K13341 peroxin-7 Length=323 Score = 38.1 bits (87), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 0/52 (0%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYT 58 +H V V +S + E L+VS WD+ VK+W T K + GH S++Y+ Sbjct 109 EHAQEVYSVDWSQTRGEQLVVSGSWDQTVKLWDPTVGKSLCTFRGHESIIYS 160 > dre:406322 poc1a, wdr51a, wu:fl82d01, zgc:56055; POC1 centriolar protein homolog A (Chlamydomonas) Length=416 Score = 38.1 bits (87), Expect = 0.006, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLI 46 +H +WV C RFSP + L+VS D+ VK+W +S +LI Sbjct 142 EHNNWVRCARFSPDGQ--LMVSVSDDRTVKLWDASSRQLI 179 Score = 31.2 bits (69), Expect = 0.75, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVW 38 H D V+CV+FSPS L+ S DK V++W Sbjct 59 HKDAVTCVQFSPSAH--LLASSSRDKTVRLW 87 > sce:YDL145C COP1, RET1, SEC33, SOO1; Alpha subunit of COPI vesicle coatomer complex, which surrounds transport vesicles in the early secretory pathway; K05236 coatomer protein complex, subunit alpha (xenin) Length=1201 Score = 38.1 bits (87), Expect = 0.007, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 0/39 (0%) Query 21 PKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 P +P+ VS G D +KVWSL + K + L GH + TV Sbjct 63 PTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTV 101 Score = 30.0 bits (66), Expect = 2.1, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCK 44 H +V C +F P+ + LIVS D+ +++W ++ + Sbjct 136 HNHFVMCAQFHPT--DDLIVSASLDETIRIWDISGLR 170 Score = 29.6 bits (65), Expect = 2.6, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Query 3 IEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKL--ITNLVGHTS 54 I EG HT V+ F P+ PLIVS D+ VK+W +++ K + GHT+ Sbjct 204 ILEG-HTRGVNWASFHPTL--PLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTN 254 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSL 40 HT+ V V F P + LI+S G DK ++VW L Sbjct 252 HTNNVDSVIFHP--HQNLIISVGEDKTLRVWDL 282 Score = 28.1 bits (61), Expect = 6.5, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGH 52 H D+V V F + P I+S D+ +++W+ + K I L GH Sbjct 94 HLDYVRTVFFHR--ELPWIISASDDQTIRIWNWQNRKEIACLTGH 136 > xla:380367 nle1, MGC52549, nle; notchless homolog 1; K14855 ribosome assembly protein 4 Length=476 Score = 38.1 bits (87), Expect = 0.007, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H ++ V FSP + +I S +DK +K+W + K +T+L GH S +Y + Sbjct 362 HQALINEVLFSPDTR--IIASASFDKSIKLWDGKTGKFLTSLRGHVSAVYQIA 412 Score = 29.6 bits (65), Expect = 2.4, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 S L+VS D +KVW + KL+ +L GH +Y+V Sbjct 414 SADSRLLVSGSSDSTLKVWDSKTKKLLIDLPGHADEVYSV 453 > dre:100004402 plrg1, MGC174842, MGC55651, MGC86603, wu:fi74f01, zgc:55651, zgc:86603; pleiotropic regulator 1; K12862 pleiotropic regulator 1 Length=511 Score = 37.7 bits (86), Expect = 0.008, Method: Compositional matrix adjust. Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query 9 TDWVSCVR-FSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 T +S VR + S + P + SCG DK VK W L K+I + GH S +Y + Sbjct 240 TGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYDL 291 Score = 32.0 bits (71), Expect = 0.49, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 H WV + P + V+ D+ +K+W L S KL +L GH S + V Sbjct 200 HLGWVRSIAVEPGNQ--WFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVA 250 Score = 27.7 bits (60), Expect = 9.4, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 25 LIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 ++V+C D +VW + + + L GHT+ + TV Sbjct 299 VLVTCSRDATARVWDIRTKANVHTLSGHTNTVATV 333 > tgo:TGME49_040650 coatomer alpha subunit, putative (EC:2.7.11.7); K05236 coatomer protein complex, subunit alpha (xenin) Length=1300 Score = 37.7 bits (86), Expect = 0.008, Method: Composition-based stats. Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 +H V + F S +PL VS G D VK+WSLT+ K I +GH L TV Sbjct 52 EHEGPVRGIDFHSS--QPLFVSGGDDYKVKLWSLTTRKCIFTFLGHLDYLRTV 102 > tpv:TP04_0666 hypothetical protein; K12862 pleiotropic regulator 1 Length=521 Score = 37.7 bits (86), Expect = 0.010, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 Y + +G H WV CV S + VS D+L+K+W L SC+L +L GH + + + Sbjct 202 YRVIKGHHG-WVHCVDVDISNE--WFVSGSADRLIKIWDLASCELKLSLTGHINTVRDI 257 Score = 32.0 bits (71), Expect = 0.48, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 S + P I SC D VK W + K++ + GH S +Y ++ Sbjct 260 STRSPYIFSCSEDNTVKCWDIEQNKVVRSYHGHLSGVYKLS 300 Score = 29.3 bits (64), Expect = 3.1, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 23 EPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 EP ++S DK V++W L+ K I L H + ++ Sbjct 347 EPQVISGSQDKTVRLWDLSMGKSIVTLTNHKKSIRAMS 384 Score = 28.9 bits (63), Expect = 3.8, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query 21 PKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVL 56 P E SC D VKVW + I N+ GH S+L Sbjct 387 PTEYSFCSCASDN-VKVWKCPEGQFIRNITGHNSIL 421 > xla:398057 paaf1, paaf, rpn14, wdr71; proteasomal ATPase-associated factor 1; K11887 proteasomal ATPase-associated factor 1 Length=376 Score = 37.4 bits (85), Expect = 0.012, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 HT V C +F PS +E ++S G D LVKVWS+ + L GH + + Sbjct 110 HTMDVFCCKFFPSGQE--VLSGGLDSLVKVWSVNDGSCLATLKGHRGSILDIA 160 > xla:495399 plrg1; pleiotropic regulator 1 (PRL1 homolog); K12862 pleiotropic regulator 1 Length=517 Score = 37.4 bits (85), Expect = 0.013, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLY 57 S + P + SCG DK VK W L K+I + GH S +Y Sbjct 258 SGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVY 295 Score = 34.7 bits (78), Expect = 0.070, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H WV C+ P + V+ D+ +K+W L S KL +L GH S + V Sbjct 206 HLGWVRCLAVEPGNQ--WFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 255 Score = 28.9 bits (63), Expect = 4.0, Method: Compositional matrix adjust. Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 21 PKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 P ++++C D ++W + + + LVGHT+ + TV Sbjct 301 PTIDVLITCSRDSTARIWDVKTKASVHTLVGHTNAVATV 339 > tpv:TP04_0117 zinc finger protein Length=370 Score = 37.4 bits (85), Expect = 0.013, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Query 3 IEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKL-ITNLVGHTS 54 + H VS VR+ + ++SCG+D+ V+VW L + K+ + NL GHT+ Sbjct 112 MRTNAHVGLVSYVRYCGQTQ---VMSCGYDRKVRVWDLRNLKIPLHNLTGHTA 161 > xla:495006 hypothetical LOC495006 Length=517 Score = 37.0 bits (84), Expect = 0.014, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLY 57 S + P + SCG DK VK W L K+I + GH S +Y Sbjct 258 SGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVY 295 Score = 31.6 bits (70), Expect = 0.66, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H WV + P + V+ D+ +K+W L S KL +L GH S + V Sbjct 206 HLGWVRSLAVEPGNQ--WFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 255 Score = 29.3 bits (64), Expect = 3.0, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 21 PKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 P ++V+C D ++W + + + LVGHT+ + TV Sbjct 301 PTIDVLVTCSRDSTARIWDVRTKASVHTLVGHTNAVATV 339 > hsa:5356 PLRG1, MGC110980, PRL1, PRP46, PRPF46; pleiotropic regulator 1 (PRL1 homolog, Arabidopsis); K12862 pleiotropic regulator 1 Length=505 Score = 37.0 bits (84), Expect = 0.014, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLY 57 S + P + SCG DK VK W L K+I + GH S +Y Sbjct 246 STRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVY 283 Score = 35.4 bits (80), Expect = 0.050, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H WV C+ P + V+ D+ +K+W L S KL +L GH S + V Sbjct 194 HLGWVRCIAVEPGNQ--WFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 243 > mmu:53317 Plrg1, AA958940, C80566; pleiotropic regulator 1, PRL1 homolog (Arabidopsis); K12862 pleiotropic regulator 1 Length=513 Score = 37.0 bits (84), Expect = 0.015, Method: Compositional matrix adjust. Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLY 57 S + P + SCG DK VK W L K+I + GH S +Y Sbjct 254 STRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVY 291 Score = 35.4 bits (80), Expect = 0.046, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H WV C+ P + V+ D+ +K+W L S KL +L GH S + V Sbjct 202 HLGWVRCIAVEPGNQ--WFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 251 > pfa:PFC0100c regulatory protein, putative; K12862 pleiotropic regulator 1 Length=600 Score = 37.0 bits (84), Expect = 0.016, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H+ WV+CV S + D+L+K+W L SCKL L GH + + + Sbjct 285 HSGWVNCVDVDIS--NEWFATGSNDRLIKIWDLASCKLKLTLTGHINSIRDI 334 Score = 36.2 bits (82), Expect = 0.027, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 0/41 (0%) Query 20 SPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 S K P + SCG D VK W L K+I + GH S +Y ++ Sbjct 337 SKKNPYLFSCGEDNRVKCWDLEYNKVIRDYHGHLSGVYCLS 377 Score = 28.9 bits (63), Expect = 3.8, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query 8 HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 H V C+ PS L++S G D +V+VW + + + L GHT + ++ Sbjct 369 HLSGVYCLSLHPSL--DLLMSGGRDAVVRVWDIRTKSSVFVLSGHTGTVMSI 418 > sce:YPR178W PRP4, RNA4; Prp4p; K12662 U4/U6 small nuclear ribonucleoprotein PRP4 Length=465 Score = 37.0 bits (84), Expect = 0.017, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 6/56 (10%) Query 4 EEGQ------HTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHT 53 +EGQ H + V+ VRFS +VSCG+D L+ V+S + + +L GHT Sbjct 382 DEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVYSSDTWLKMGSLAGHT 437 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 25 LIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 L+ S G D L +W + S + L GH+ +YTV Sbjct 321 LVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTV 355 > cel:D1054.15 tag-135; Temporarily Assigned Gene name family member (tag-135); K12862 pleiotropic regulator 1 Length=494 Score = 36.6 bits (83), Expect = 0.018, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query 1 YTIEEGQHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTV 59 Y + G HT WV V P + S G D+++K+W L S +L +L GH S + V Sbjct 177 YRVASG-HTGWVRAVDVEPGNQ--WFASGGADRIIKIWDLASGQLKLSLTGHISSVRAV 232 Score = 33.9 bits (76), Expect = 0.13, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query 9 TDWVSCVR-FSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLYTVT 60 T +S VR SP+ P + S G DK VK W L K+I + GH S + ++ Sbjct 223 TGHISSVRAVKVSPRHPFLFSGGEDKQVKCWDLEYNKVIRHYHGHLSAVQALS 275 > xla:444261 apaf1, MGC80868, apaf-1; apoptotic peptidase activating factor 1; K02084 apoptotic protease-activating factor Length=1248 Score = 36.6 bits (83), Expect = 0.019, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 0/51 (0%) Query 7 QHTDWVSCVRFSPSPKEPLIVSCGWDKLVKVWSLTSCKLITNLVGHTSVLY 57 +HT+ V+C +F+ PL+ +C D + +W + L+GHT +Y Sbjct 697 EHTEQVNCCQFTNGLSAPLLATCSNDCFIMLWDSETEYSRNTLIGHTGAVY 747 Lambda K H 0.319 0.133 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2069361540 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40