bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_2836_orf1 Length=56 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_052220 Hsc70/Hsp90-organizing protein, putative ; K... 79.3 3e-15 bbo:BBOV_III002230 17.m07215; tetratricopeptide repeat domain ... 75.9 3e-14 tpv:TP03_0587 hypothetical protein; K09553 stress-induced-phos... 73.6 1e-13 pfa:PF14_0324 Hsp70/Hsp90 organizing protein, putative; K09553... 65.1 5e-11 cpv:cgd2_1850 stress-induced protein sti1-like protein 60.8 1e-09 ath:AT1G62740 stress-inducible protein, putative; K09553 stres... 51.2 7e-07 ath:AT4G12400 stress-inducible protein, putative 48.1 6e-06 ath:AT1G12270 stress-inducible protein, putative 45.8 3e-05 dre:493606 stip1, zgc:92133; stress-induced-phosphoprotein 1 (... 33.9 0.14 dre:393286 ttc25, MGC56362, zgc:56362; tetratricopeptide repea... 33.1 0.23 xla:447010 stip1, MGC82554; stress-induced-phosphoprotein 1 (H... 32.0 0.50 xla:379955 stip1, MGC53256; stress-induced-phosphoprotein 1; K... 31.6 0.59 tgo:TGME49_116440 phosphatidylinositol 3- and 4-kinase domain-... 31.6 0.71 dre:100001239 interferon-induced protein with tetratricopeptid... 30.4 1.5 hsa:10963 STIP1, HOP, IEF-SSP-3521, P60, STI1, STI1L; stress-i... 30.0 1.8 mmu:20867 Stip1, Hop, Sti1, p60; stress-induced phosphoprotein... 30.0 1.9 dre:100001211 LReO_3-like 29.3 3.3 tgo:TGME49_029490 TPR domain-containing protein 29.3 3.5 hsa:23331 TTC28, KIAA1043; tetratricopeptide repeat domain 28 28.9 ath:AT4G11260 SGT1B; SGT1B; protein binding; K12795 suppressor... 28.9 4.1 xla:379791 dnajc3, MGC53466, cg8286; DnaJ (Hsp40) homolog, sub... 28.5 5.1 mmu:209683 Ttc28, 2310015L07Rik, 6030435N04, AI428795, AI85176... 28.1 6.6 ath:AT4G37460 SRFR1; SRFR1 (SUPPRESSOR OF RPS4-RLD 1); protein... 28.1 6.8 dre:100005214 TTC3 protein-like 28.1 7.2 mmu:67955 Sugt1, 2410174K12Rik, SGT1; SGT1, suppressor of G2 a... 28.1 7.4 hsa:7268 TTC4, DKFZp781B0622, FLJ41930, MGC5097; tetratricopep... 28.1 7.5 xla:735194 hypothetical protein MGC131307 28.1 7.5 dre:567504 interferon-induced protein with tetratricopeptide r... 27.7 8.3 xla:446699 dyx1c1, EKN1, MGC83582; dyslexia susceptibility 1 c... 27.7 8.7 cel:ZK370.8 hypothetical protein 27.7 9.1 tgo:TGME49_068000 hypothetical protein 27.7 9.5 xla:432309 sugt1, MGC79143; SGT1, suppressor of G2 allele of S... 27.7 9.6 pfa:PFL2015w tetratricopeptide repeat domain 1-like protein, p... 27.7 9.9 > tgo:TGME49_052220 Hsc70/Hsp90-organizing protein, putative ; K09553 stress-induced-phosphoprotein 1 Length=565 Score = 79.3 bits (194), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 38/57 (66%), Positives = 47/57 (82%), Gaps = 1/57 (1%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQ-QQSGEIDEEQ 56 SRKG+LH LKEY KAL+AFDKGLA++P ++EC+ GKM V+ KVQQ Q SGE+D EQ Sbjct 451 SRKGNLHMLLKEYPKALQAFDKGLALEPTNQECIQGKMAVMNKVQQLQSSGEVDPEQ 507 Score = 33.1 bits (74), Expect = 0.21, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 0/46 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQ 46 SRKG F++ +Y +A + KGL +DP +++ +G QV ++ Q Sbjct 79 SRKGLAEFRMMKYKEAEATYHKGLQVDPTNEQLKEGLNQVQQQTDQ 124 > bbo:BBOV_III002230 17.m07215; tetratricopeptide repeat domain containing protein; K09553 stress-induced-phosphoprotein 1 Length=546 Score = 75.9 bits (185), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 35/57 (61%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQ-QQQSGEIDEEQ 56 +RKG+LH LKEY+KALEA+DKGLA+DPN++EC+ GK + K+Q QSG +DEEQ Sbjct 432 ARKGNLHVLLKEYSKALEAYDKGLALDPNNQECITGKYDCMAKIQAMSQSGTVDEEQ 488 Score = 28.9 bits (63), Expect = 4.0, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQV 40 SRKG ++L +A A+ +GL IDP ++ M G +V Sbjct 73 SRKGLALYKLGRLQEARTAYQEGLKIDPANEPLMSGLREV 112 > tpv:TP03_0587 hypothetical protein; K09553 stress-induced-phosphoprotein 1 Length=540 Score = 73.6 bits (179), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 30/56 (53%), Positives = 43/56 (76%), Gaps = 0/56 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 +RKG+LH LKEY KA++++DKGL +DPN+ EC+ G+ + K+Q+ GEIDEEQ Sbjct 427 ARKGNLHVLLKEYHKAMDSYDKGLKVDPNNNECLQGRNNCLNKIQEMNKGEIDEEQ 482 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 0/40 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQV 40 SRKG ++L KA E ++ GLA DPN++ ++V Sbjct 73 SRKGLCEYKLGNPEKAKETYNMGLAYDPNNESLNKALLEV 112 > pfa:PF14_0324 Hsp70/Hsp90 organizing protein, putative; K09553 stress-induced-phosphoprotein 1 Length=564 Score = 65.1 bits (157), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 29/57 (50%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGE-IDEEQ 56 SRKG+LHF +K+Y KAL+A++KGL +DPN+KEC++G + K+ + E +DEEQ Sbjct 450 SRKGNLHFFMKDYYKALQAYNKGLELDPNNKECLEGYQRCAFKIDEMSKSEKVDEEQ 506 Score = 28.1 bits (61), Expect = 7.9, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQV 40 RKG L++ + A + + +GL IDPN+K D +V Sbjct 80 RKGCAEHGLRQLSNAEKTYLEGLKIDPNNKSLQDALSKV 118 > cpv:cgd2_1850 stress-induced protein sti1-like protein Length=326 Score = 60.8 bits (146), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/57 (52%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQ-QQSGEIDEEQ 56 SRKG++H+ LKEY KAL A+ +GL DP++KEC +G + K+QQ S +IDEEQ Sbjct 212 SRKGNIHYFLKEYHKALHAYQEGLKCDPDNKECNEGLKNTMAKIQQVSSSDQIDEEQ 268 > ath:AT1G62740 stress-inducible protein, putative; K09553 stress-induced-phosphoprotein 1 Length=571 Score = 51.2 bits (121), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 38/56 (67%), Gaps = 0/56 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 SRKG++ F +KEY A+E + KGL DPN++E +DG + V+++ + G++ E+ Sbjct 454 SRKGAVQFFMKEYDNAMETYQKGLEHDPNNQELLDGVKRCVQQINKANRGDLTPEE 509 Score = 34.7 bits (78), Expect = 0.068, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 SR G+ H L ++ +A+EA+ KGL IDP+++ G Sbjct 74 SRLGAAHLGLNQFDEAVEAYSKGLEIDPSNEGLKSG 109 > ath:AT4G12400 stress-inducible protein, putative Length=558 Score = 48.1 bits (113), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 37/56 (66%), Gaps = 0/56 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 SRKG++ F +KEY KA+E + +GL DP ++E +DG + V ++ + G++ E+ Sbjct 441 SRKGAIQFFMKEYDKAMETYQEGLKHDPKNQEFLDGVRRCVEQINKASRGDLTPEE 496 > ath:AT1G12270 stress-inducible protein, putative Length=572 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 36/56 (64%), Gaps = 0/56 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 SRK ++ F LKEY A+E + GL DP+++E +DG + V+++ + G++ E+ Sbjct 455 SRKAAVQFFLKEYDNAMETYQAGLEHDPSNQELLDGVKRCVQQINKANRGDLTPEE 510 Score = 31.2 bits (69), Expect = 0.91, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 SR G+ H L ++ A+ A+ KGL +DP ++ G Sbjct 74 SRLGAAHLGLNQFELAVTAYKKGLDVDPTNEALKSG 109 > dre:493606 stip1, zgc:92133; stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein); K09553 stress-induced-phosphoprotein 1 Length=542 Score = 33.9 bits (76), Expect = 0.14, Method: Compositional matrix adjust. Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 +RKG+ +K+++KA++ + K L +D NSKE +G Sbjct 431 TRKGAALEAMKDFSKAMDVYQKALELDSNSKEATEG 466 > dre:393286 ttc25, MGC56362, zgc:56362; tetratricopeptide repeat domain 25 Length=486 Score = 33.1 bits (74), Expect = 0.23, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 0/48 (0%) Query 8 FQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEE 55 FQ EY KA+E+F L + P++K C+ + + K+ ++ D E Sbjct 25 FQRGEYVKAVESFTTALTLQPDNKNCLVSRSRCYVKLGDAENALKDAE 72 > xla:447010 stip1, MGC82554; stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein); K09553 stress-induced-phosphoprotein 1 Length=430 Score = 32.0 bits (71), Expect = 0.50, Method: Compositional matrix adjust. Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 +RK + +K+Y+KA++A+ K +D SKE DG Sbjct 319 TRKAAALEAMKDYSKAMDAYQKATELDSTSKEAKDG 354 > xla:379955 stip1, MGC53256; stress-induced-phosphoprotein 1; K09553 stress-induced-phosphoprotein 1 Length=543 Score = 31.6 bits (70), Expect = 0.59, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 +RK + +K++ KA++A+ K + +D SKE DG Sbjct 432 TRKAAALEAMKDFTKAMDAYQKAMELDSTSKEATDG 467 > tgo:TGME49_116440 phosphatidylinositol 3- and 4-kinase domain-containing protein (EC:4.1.1.70 2.7.11.1) Length=2896 Score = 31.6 bits (70), Expect = 0.71, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 27/40 (67%), Gaps = 0/40 (0%) Query 7 HFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQ 46 + QL E+ +ALEA+++ DP++ E + GKM+ +R + + Sbjct 1022 YVQLGEWEQALEAYEQREREDPSNAEWLKGKMRCLRALGE 1061 > dre:100001239 interferon-induced protein with tetratricopeptide repeats 5-like Length=483 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Query 6 LHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQ 45 L F K Y +A+EAF K + +DP + E G + +++ Sbjct 148 LKFSYKYYDRAVEAFQKAVELDPENSEWNAGYATALYRIE 187 > hsa:10963 STIP1, HOP, IEF-SSP-3521, P60, STI1, STI1L; stress-induced-phosphoprotein 1; K09553 stress-induced-phosphoprotein 1 Length=543 Score = 30.0 bits (66), Expect = 1.8, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 +RK + +K+Y KA++ + K L +D + KE DG Sbjct 432 TRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADG 467 > mmu:20867 Stip1, Hop, Sti1, p60; stress-induced phosphoprotein 1; K09553 stress-induced-phosphoprotein 1 Length=543 Score = 30.0 bits (66), Expect = 1.9, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 1 SRKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 +RK + +K+Y KA++ + K L +D + KE DG Sbjct 432 TRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADG 467 > dre:100001211 LReO_3-like Length=979 Score = 29.3 bits (64), Expect = 3.3, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 0/55 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 R+G L +A AL AF GLA DP S + + G ++ K ++S E +Q Sbjct 805 RQGVALQYLGRHADALAAFASGLAQDPKSLQLLVGMVEAAMKSPLRESLEPTYQQ 859 > tgo:TGME49_029490 TPR domain-containing protein Length=823 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVR 42 R+G H Q + KA E + L +PNSKE D +Q++R Sbjct 222 RRGLAHLQQDNFVKAKEDLMEALTQEPNSKEIRDA-LQLLR 261 > hsa:23331 TTC28, KIAA1043; tetratricopeptide repeat domain 28 Length=2481 Score = 28.9 bits (63), Expect = 3.7, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 0/55 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 R+G L +A AL AF GLA DP S + + G ++ K + S E +Q Sbjct 131 RQGVALQYLGRHADALAAFASGLAQDPKSLQLLVGMVEAAMKSPMRDSLEPTYQQ 185 > ath:AT4G11260 SGT1B; SGT1B; protein binding; K12795 suppressor of G2 allele of SKP1 Length=358 Score = 28.9 bits (63), Expect = 4.1, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPN 29 RKG+ +L+EY+ A A +KG ++ PN Sbjct 75 RKGTACMKLEEYSTAKAALEKGASVAPN 102 > xla:379791 dnajc3, MGC53466, cg8286; DnaJ (Hsp40) homolog, subfamily C, member 3; K09523 DnaJ homolog subfamily C member 3 Length=502 Score = 28.5 bits (62), Expect = 5.1, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 0/46 (0%) Query 6 LHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGE 51 +++QL ++ +L + L +DP+ KEC QV + +Q Q+ E Sbjct 231 IYYQLGDHEMSLSEIRECLKLDPDHKECFSHYKQVKKLNKQIQAAE 276 > mmu:209683 Ttc28, 2310015L07Rik, 6030435N04, AI428795, AI851761, BC002262, MGC7623; tetratricopeptide repeat domain 28 Length=2481 Score = 28.1 bits (61), Expect = 6.6, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 0/47 (0%) Query 10 LKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 L +A AL AF GLA DP S + + G ++ K + + E +Q Sbjct 133 LGRHADALAAFASGLAQDPKSLQLLVGMVEAAMKSPMRDTLEPTYQQ 179 > ath:AT4G37460 SRFR1; SRFR1 (SUPPRESSOR OF RPS4-RLD 1); protein complex scaffold Length=1052 Score = 28.1 bits (61), Expect = 6.8, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECM 34 R+G L EY +A+E K L +PNS + + Sbjct 370 RRGQARAALGEYVEAVEDLTKALVFEPNSPDVL 402 > dre:100005214 TTC3 protein-like Length=715 Score = 28.1 bits (61), Expect = 7.2, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 3 KGSLHFQLKEYAKALEAFDKGLAIDPNS 30 KG+ HFQ K+Y AL+ + K + PN+ Sbjct 218 KGNEHFQKKKYDVALKWYSKAIKYHPNN 245 > mmu:67955 Sugt1, 2410174K12Rik, SGT1; SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae); K12795 suppressor of G2 allele of SKP1 Length=336 Score = 28.1 bits (61), Expect = 7.4, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEEQ 56 RKG + K+YA ALE F +G +D ++ D ++ +++Q E+ Q Sbjct 84 RKGICEYHEKDYASALETFAEGQKLD-STDTNFDTWIKRCQEIQNGSESEVSASQ 137 > hsa:7268 TTC4, DKFZp781B0622, FLJ41930, MGC5097; tetratricopeptide repeat domain 4 Length=387 Score = 28.1 bits (61), Expect = 7.5, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Query 3 KGSL-HFQLKEYAKALEAFDKGLAIDPNSKEC--MDGKMQVVRKVQQQ 47 +G+L H +LK +A+A+ D+GL ID K+ M K +++++Q+ Sbjct 156 RGALCHLELKHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIEQR 203 > xla:735194 hypothetical protein MGC131307 Length=151 Score = 28.1 bits (61), Expect = 7.5, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query 7 HFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQ 47 H++LKEY KAL+ L+ +P + + +D + +V+ K Q+ Sbjct 81 HYRLKEYEKALKYVRTLLSAEPKNNQALDLE-KVIEKAMQK 120 > dre:567504 interferon-induced protein with tetratricopeptide repeats 5-like Length=474 Score = 27.7 bits (60), Expect = 8.3, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 0/31 (0%) Query 6 LHFQLKEYAKALEAFDKGLAIDPNSKECMDG 36 L F K Y KA+E F K + +DP + E G Sbjct 150 LKFSRKYYDKAVEVFQKAVELDPTNSEWNAG 180 > xla:446699 dyx1c1, EKN1, MGC83582; dyslexia susceptibility 1 candidate 1 Length=421 Score = 27.7 bits (60), Expect = 8.7, Method: Compositional matrix adjust. Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEID 53 R+G+ +L+ Y + L+ ++ L IDP ++ M + +R+V Q +I+ Sbjct 361 RRGTAFCELELYVEGLQDYEAALKIDPTNQN-MKSDAEKIRRVIQSSLPDIE 411 > cel:ZK370.8 hypothetical protein Length=569 Score = 27.7 bits (60), Expect = 9.1, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query 4 GSLHFQLKEYAKALEAFDKGL-AIDPNSKE 32 G+L F+ K+Y ALEAF KG+ PNS + Sbjct 51 GNLKFKEKQYDSALEAFTKGVEKAGPNSSD 80 > tgo:TGME49_068000 hypothetical protein Length=1204 Score = 27.7 bits (60), Expect = 9.5, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 10 LKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGE 51 + EY LE G +DP+ +E + + VR Q+++ GE Sbjct 106 VSEYRTILEREKAGHPVDPDEQEAAEATLCAVRDSQRREEGE 147 > xla:432309 sugt1, MGC79143; SGT1, suppressor of G2 allele of SKP1; K12795 suppressor of G2 allele of SKP1 Length=331 Score = 27.7 bits (60), Expect = 9.6, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNS 30 RKG F L+ Y+ A E+F KG +D ++ Sbjct 79 RKGEAEFHLQNYSSAEESFRKGQMLDTST 107 > pfa:PFL2015w tetratricopeptide repeat domain 1-like protein, putative Length=676 Score = 27.7 bits (60), Expect = 9.9, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 0/54 (0%) Query 2 RKGSLHFQLKEYAKALEAFDKGLAIDPNSKECMDGKMQVVRKVQQQQSGEIDEE 55 R+ + + QL++Y A +K L IDPN + K + ++++ +QQ + EE Sbjct 580 RRSNAYEQLQKYNDASNDLNKALTIDPNLLKNYQVKQRKLKELAEQQLNKEKEE 633 Lambda K H 0.311 0.128 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2005549208 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40