bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3028_orf2 Length=53 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_063300 porin, putative ; K15040 voltage-dependent a... 60.5 1e-09 > tgo:TGME49_063300 porin, putative ; K15040 voltage-dependent anion channel protein 2 Length=290 Score = 60.5 bits (145), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 25/34 (73%), Positives = 30/34 (88%), Gaps = 0/34 (0%) Query 20 MVLFKDIGKPASDLLKKGFPHEKSWELEYKYKSK 53 MVLFKD+ K +DLL KG+PHEK+W+LEYKYKSK Sbjct 1 MVLFKDLNKSCADLLTKGYPHEKAWDLEYKYKSK 34 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2018379896 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40