bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3091_orf1 Length=147 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 i... 74.3 1e-13 cel:F59B1.10 hypothetical protein 30.0 2.5 ath:AT3G22150 pentatricopeptide (PPR) repeat-containing protein 29.6 3.2 mmu:21335 Tacc3, Aint, C86661, Eric1; transforming, acidic coi... 29.6 3.3 dre:100005469 fn1, Fn, fb80d10, fn2, wu:fb80d10; fibronectin 1... 29.6 3.6 cel:F11A10.1 lex-1; Lin-48 EXpression abnormal family member (... 29.6 3.9 dre:562403 hypothetical LOC562403 29.3 4.5 xla:431997 coro2a, MGC81182; coronin, actin binding protein, 2A 28.9 5.4 mmu:433938 Mn1, AA003644, AA009236; meningioma 1 28.9 tgo:TGME49_053870 hypothetical protein 28.9 5.9 > tgo:TGME49_057010 insulysin, putative (EC:3.4.24.56); K01408 insulysin [EC:3.4.24.56] Length=953 Score = 74.3 bits (181), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 0/76 (0%) Query 1 KEAAHAKLTKMEANFSEDFKKSAEEIFAHSNCFTKRDLEVKYLDNDFSRKQLLRTFAKLS 60 KE+A A+L K F E+F +S +I H +CF KRDLE+ YL+ +F+RKQL RT+ KL Sbjct 868 KESARAELEKPTETFYEEFGRSWGQIANHGHCFNKRDLELIYLNTEFNRKQLSRTYTKLL 927 Query 61 DPSRRMVVKLIADLEP 76 +P+RR+V ++ + P Sbjct 928 EPTRRLVGFVLNHVTP 943 Score = 46.2 bits (108), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 0/45 (0%) Query 102 EMARWKEAAHAKLTKMEANFSEDFKKSAEEIFAHSNCFTKRDMEV 146 E+ WKE+A A+L K F E+F +S +I H +CF KRD+E+ Sbjct 863 ELDHWKESARAELEKPTETFYEEFGRSWGQIANHGHCFNKRDLEL 907 > cel:F59B1.10 hypothetical protein Length=428 Score = 30.0 bits (66), Expect = 2.5, Method: Compositional matrix adjust. Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Query 38 LEVKYLDNDFSRKQLLRTFAKLSDPSRRMVVKLIADLEPEKEV-TLIGEAKAQDAALLRR 96 +EV N FS + LL + + PS + KLI + + LI + K Q+A+L+ + Sbjct 45 MEVIGDGNGFSSRVLLIS-CNWTIPSAHLPKKLILKIVSFVHIQALIDKGKQQNASLITK 103 Query 97 GDTTEEMARWKEAAHAKLTKMEANFSE 123 + E+M + E++ K+ E NF E Sbjct 104 -EVEEQMYAYFESSCKKMHNQEMNFYE 129 > ath:AT3G22150 pentatricopeptide (PPR) repeat-containing protein Length=820 Score = 29.6 bits (65), Expect = 3.2, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 0/44 (0%) Query 102 EMARWKEAAHAKLTKMEANFSEDFKKSAEEIFAHSNCFTKRDME 145 E +WK + E ++ +S EI + NCF RD E Sbjct 739 EEQKWKSVDKVRRGMREKGLKKEVGRSGIEIAGYVNCFVSRDQE 782 > mmu:21335 Tacc3, Aint, C86661, Eric1; transforming, acidic coiled-coil containing protein 3; K14283 transforming acidic coiled-coil-containing protein 3 Length=630 Score = 29.6 bits (65), Expect = 3.3, Method: Composition-based stats. Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 14/109 (12%) Query 19 FKKSAEEIFAHSNCFTKRDLEVKYLDNDFSRKQLLRTFAKLSDPSRRMVVKLIADLEPEK 78 K S +++ A N + +LE+K D + K L K D ++ K + + E ++ Sbjct 426 LKYSQKDLDAVVNVMQQENLELKSKYEDLNTKYL--EMGKSVDEFEKIAYKSLEEAEKQR 483 Query 79 EVTLIGEAKAQDAALLRRGDTTEEMARWKEAAHAKLTKMEANFSEDFKK 127 E+ I E K Q ++ + ++ +A L ME +FS+ FK+ Sbjct 484 ELKEIAEDKIQ------------KVLKERDQLNADLNSMEKSFSDLFKR 520 > dre:100005469 fn1, Fn, fb80d10, fn2, wu:fb80d10; fibronectin 1; K05717 fibronectin 1 Length=2478 Score = 29.6 bits (65), Expect = 3.6, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query 49 RKQLLRTFAKLSD--PSRRMVVKLIADLEPEKEVTLIGEAKAQ 89 R Q RTFA +S P ++K++A ++ LIG+A+ Q Sbjct 2044 RPQAARTFASISGLIPGTEYIIKIVALNGAQRSTPLIGKARTQ 2086 > cel:F11A10.1 lex-1; Lin-48 EXpression abnormal family member (lex-1) Length=1291 Score = 29.6 bits (65), Expect = 3.9, Method: Compositional matrix adjust. Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Query 8 LTKMEANFSEDFKKSAEEIFAHSNCFT----KRDLEVKYLDNDFSRKQLLRTFAKLSDPS 63 L+ ++ +F ED + EIF H+NC T +R + KY ++ + + T K+ DP+ Sbjct 825 LSTLDTSF-EDAPEYVTEIFRHANCITLNPSRRTIRQKYFEHVIEK---INTPPKVFDPT 880 > dre:562403 hypothetical LOC562403 Length=776 Score = 29.3 bits (64), Expect = 4.5, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Query 17 EDFKKSAEEIFAHSNCFTKRDLEVKYLDNDFSRKQLLRTFAKLSDPSR 64 +D ++ AE +FAH +R+ + + + N + KQL +T +++SD SR Sbjct 432 QDLRQHAE-VFAHQMLVKQRETQ-RQIQNAETEKQLQQTLSQVSDISR 477 > xla:431997 coro2a, MGC81182; coronin, actin binding protein, 2A Length=525 Score = 28.9 bits (63), Expect = 5.4, Method: Composition-based stats. Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Query 65 RMVVKLIADLEPEKEVTLIGEAKAQDAALLRRGDTTEEMARWKEAAHAKLTKMEANFSED 124 +M K + ++E + E+ I E ++ A R DT + M+ + K E + Sbjct 429 KMPTKTLWEIEYKTEI--IREDRSNKKAFERLQDTKQAMSNGFDIFECPPPKTENELLQM 486 Query 125 FKKSAEEIFAHSNCFTKRDMEVK 147 F K EEI + +RD+++K Sbjct 487 FYKQQEEIRRLRDQINQRDVQIK 509 > mmu:433938 Mn1, AA003644, AA009236; meningioma 1 Length=1297 Score = 28.9 bits (63), Expect = 5.4, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 0/51 (0%) Query 90 DAALLRRGDTTEEMARWKEAAHAKLTKMEANFSEDFKKSAEEIFAHSNCFT 140 D AL+ GD + +A W++A EA+ K SA + +H C T Sbjct 1211 DKALVDGGDEDKTLAPWEKAKSQNPNNKEAHDHPTNKASATQPGSHLQCLT 1261 > tgo:TGME49_053870 hypothetical protein Length=4787 Score = 28.9 bits (63), Expect = 5.9, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query 5 HAKLTKMEA--NFSEDFKKSAEEIFAHSNCFTKR 36 + +L K+E FS DF KSA I H+ C KR Sbjct 2244 YTRLGKLERLLRFSADFTKSAHHILLHAACLRKR 2277 Score = 28.9 bits (63), Expect = 5.9, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query 111 HAKLTKMEA--NFSEDFKKSAEEIFAHSNCFTKR 142 + +L K+E FS DF KSA I H+ C KR Sbjct 2244 YTRLGKLERLLRFSADFTKSAHHILLHAACLRKR 2277 Lambda K H 0.315 0.127 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2938175820 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40