bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 164,496 sequences; 82,071,388 total letters Query= Emax_3251_orf2 Length=73 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_100100 rhoptry neck protein 2 (EC:3.2.1.39); K14145... 89.7 2e-18 bbo:BBOV_I001630 19.m02019; hypothetical protein; K14145 rhopt... 46.6 2e-05 tpv:TP01_0014 hypothetical protein; K14145 rhoptry neck protein 2 43.5 pfa:PF14_0495 PfRON2; rhoptry neck protein 2; K14145 rhoptry n... 32.7 0.26 bbo:BBOV_I003210 19.m02136; hypothetical protein; K14314 nucle... 31.2 0.80 mmu:269060 Dagla, KIAA0659, Nsddr; diacylglycerol lipase, alph... 31.2 0.87 mmu:14766 Gpr56, Cyt28, TM7LN4, TM7XN1; G protein-coupled rece... 30.8 1.1 cel:Y26E6A.3 hypothetical protein 29.6 2.6 cel:C15H9.1 nnt-1; Nicotinamide Nucleotide Transhydrogenase fa... 28.1 7.5 > tgo:TGME49_100100 rhoptry neck protein 2 (EC:3.2.1.39); K14145 rhoptry neck protein 2 Length=1404 Score = 89.7 bits (221), Expect = 2e-18, Method: Composition-based stats. Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 0/71 (0%) Query 1 ISYDKIAIPDLTRWEKEINNKWLHALSAYLSHPYGAAAAAAGDPVALLVKESKERLEKEI 60 +S+ I IP+LT W+ ++N+KWL A +AYL HPYG AA A DPVALLVK+S++RL+ E Sbjct 858 MSFGGIPIPNLTNWDAQLNSKWLEAYNAYLRHPYGRAALNARDPVALLVKDSRDRLQAEA 917 Query 61 DNTIFLGRVVQ 71 + TIFLGR+ + Sbjct 918 EGTIFLGRIAK 928 > bbo:BBOV_I001630 19.m02019; hypothetical protein; K14145 rhoptry neck protein 2 Length=1365 Score = 46.6 bits (109), Expect = 2e-05, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 0/61 (0%) Query 13 RWEKEINNKWLHALSAYLSHPYGAAAAAAGDPVALLVKESKERLEKEIDNTIFLGRVVQT 72 RWEK +N+ L +A+L P + +VK+S++ LE+ +D TIF GRVV Sbjct 867 RWEKHLNSLILDGYNAFLDLPSIKVLDGRHSLIYEIVKDSRDNLEQHLDETIFFGRVVNP 926 Query 73 P 73 P Sbjct 927 P 927 > tpv:TP01_0014 hypothetical protein; K14145 rhoptry neck protein 2 Length=788 Score = 43.5 bits (101), Expect = 2e-04, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 39/63 (61%), Gaps = 4/63 (6%) Query 13 RWEKEINNKWLHALSAYLSHPYGAAAAAAGDPVAL--LVKESKERLEKEIDNTIFLGRVV 70 +W+K +N + L + + +L G+ A G L +VK+S++ LE+ I+NTIF GR++ Sbjct 298 KWDKSLNTEILKSFNEFLE--LGSVKALEGRNHILYEVVKDSRDNLEQNIENTIFFGRIL 355 Query 71 QTP 73 +P Sbjct 356 NSP 358 > pfa:PF14_0495 PfRON2; rhoptry neck protein 2; K14145 rhoptry neck protein 2 Length=2189 Score = 32.7 bits (73), Expect = 0.26, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Query 13 RWEKEINNKWLHALSAYLSHPYGAAAAAAGDPVALLVKESKERLEKEIDNTIFLGRVVQ 71 +W++ IN + + AL +L + A V +V++SK LE IDN I R V+ Sbjct 1688 KWDQFINKELVRALGLWLE--FNDNPTNASSFVYKVVEDSKHLLENNIDNNIIFSRTVK 1744 > bbo:BBOV_I003210 19.m02136; hypothetical protein; K14314 nuclear pore complex protein Nup210 Length=2236 Score = 31.2 bits (69), Expect = 0.80, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Query 12 TRWEKEINNKWLHALSAYLSHPYGAAAAAAGD------PVALLVKESKERLEKEIDNTIF 65 T+W+ +N HA A + P+G + PVA L KES ++ID +I+ Sbjct 907 TKWQVRVNQFGTHAFRAVVYDPFGIPLCPIHNYNLSWRPVAQLPKESGTASYQKIDGSIY 966 Query 66 L 66 + Sbjct 967 I 967 > mmu:269060 Dagla, KIAA0659, Nsddr; diacylglycerol lipase, alpha; K13806 sn1-specific diacylglycerol lipase alpha [EC:3.1.1.-] Length=1044 Score = 31.2 bits (69), Expect = 0.87, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 30 LSHPYGAAAAAAGDPVALLVKESKERLEKEIDN 62 L P AA+AA DPV LL+ ++ERL E+ + Sbjct 742 LLSPVAAASAARQDPVELLLLSTQERLAAELQS 774 > mmu:14766 Gpr56, Cyt28, TM7LN4, TM7XN1; G protein-coupled receptor 56; K08450 G protein-coupled receptor 56 Length=687 Score = 30.8 bits (68), Expect = 1.1, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Query 21 KWLHALSAYLSHPYGAAAAAAGDPVALLVKESKERLEKEIDNTIFLG 67 K L LS YL HP AA P A + + + LE ++ + FLG Sbjct 181 KELQQLSRYLQHP----QKAAKRPTAAFISQQLQSLESKLTSVSFLG 223 > cel:Y26E6A.3 hypothetical protein Length=204 Score = 29.6 bits (65), Expect = 2.6, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 7 AIPDLTRWEKEINNKWLHALSAYL 30 A+PD+T E+N ++LH++ +YL Sbjct 45 ALPDVTFQPTEVNGRYLHSIVSYL 68 > cel:C15H9.1 nnt-1; Nicotinamide Nucleotide Transhydrogenase family member (nnt-1); K00323 NAD(P) transhydrogenase [EC:1.6.1.2] Length=1041 Score = 28.1 bits (61), Expect = 7.5, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 0/39 (0%) Query 17 EINNKWLHALSAYLSHPYGAAAAAAGDPVALLVKESKER 55 E + L+A S + YG AA A P+A LVKE ++R Sbjct 872 ETADMLLNARSVIIIPGYGLCAAQAQYPIAQLVKELQQR 910 Lambda K H 0.315 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2011623444 Database: egene_temp_file_orthology_annotation_similarity_blast_database_865 Posted date: Sep 17, 2011 11:19 AM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40