bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0016_orf2 Length=121 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P1.9 91.7 6e-18 > 5833.MAL3P1.9 Length=1254 Score = 91.7 bits (226), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 48/117 (41%), Positives = 77/117 (65%), Gaps = 5/117 (4%) Query 1 RIVAFRLVENEQQGLTQENVTKSLIDLLCRSFQTLNPKQVEAFVLDLFNFCVDSNPSRFQ 60 R++ F +V + +T+ ++ K + + L +SF+ LN KQ+E F +D+FNFCV+S PS F+ Sbjct 1129 RLLEFEVVNIPEVEITKPHIIKHVQNFLTQSFENLNQKQIETFSVDMFNFCVES-PSAFR 1187 Query 61 EHMRDFLISLKEFAGDNEALFEAERKEALARAAELEKQK----RGMVPGLLPQYESM 113 +RD LISLKEFA + + L+EA+R+EAL RA E K RG++ +P + ++ Sbjct 1188 SFVRDLLISLKEFATNQDELYEADRQEALQRAKMAEDNKLIKLRGLMKEDVPSFSAI 1244 Lambda K H 0.320 0.135 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40