bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0043_orf1 Length=376 Score E Sequences producing significant alignments: (Bits) Value 101510.RHA1_ro03040 110 1e-22 > 101510.RHA1_ro03040 Length=509 Score = 110 bits (274), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 79/207 (38%), Positives = 99/207 (47%), Gaps = 29/207 (14%) Query 28 GCRVTEVYWSAVYKSAVRMASVLRRKRLLLAGDAAHVHPSILGQGMNLGMQNAYNLGWKL 87 G R++E W + + VRM R R+ LAGDAAHVHP G GMN G+Q+AYNLGWKL Sbjct 250 GVRLSEPTWLSTWHVNVRMVDCFRDGRVFLAGDAAHVHPPAGGLGMNTGIQDAYNLGWKL 309 Query 88 ARVLRHGASPQLLDSYSEEAKQAAEQVVGLSDRFFQSVLSANGSGGLLSRLLLRMGAAVA 147 A VL A P LLD+Y EE A +G+S Q V S +G + Sbjct 310 ALVLAGSADPSLLDTYQEERLPLARWTLGVSSAGLQKVAS-------------NLGREDS 356 Query 148 SHLPSAARSFGQTLLMTRISYPQPSIALGNGDSSFISGLKPGCRAPD--CLVKVARFPKM 205 A GQ L + YP S++ D +GL+ G RAPD CL P Sbjct 357 EGFAGAVTEDGQQL---GLGYPWSSLSW---DGEATTGLRAGDRAPDAPCLS-----PDG 405 Query 206 HPPDVADPVAGYLFELLGKG---RHLL 229 P + D G F +LG G RH+L Sbjct 406 TPLRLFDVFRGTHFTVLGFGGGSRHIL 432 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 145786424286 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40