bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0059_orf1 Length=186 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0226 142 4e-33 > 5833.PF13_0226 Length=462 Score = 142 bits (359), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 82/185 (44%), Positives = 116/185 (62%), Gaps = 18/185 (9%) Query 1 DTIEKKVPKIIEVPKYVDTVKYVWKPVEKIVHVERFVPKFDVSLECPAPLIVPYPVQKVT 60 DT+EK+VPKIIEVPKYVD VKYVWKP+EKIV+V++ +PKFDV+LECP PLIVPYPVQ++ Sbjct 268 DTVEKRVPKIIEVPKYVDEVKYVWKPIEKIVYVQKLIPKFDVNLECPPPLIVPYPVQRIK 327 Query 61 EMPAVMVRKNPAEIQETE-VEVVSPDGTVRVPEEYIREYRKTKGQDAGLLCQTMECCG-- 117 ++ VMV+KN EI + ++ SP+G++ +PEEYI Y + + + GLL CC Sbjct 328 QISPVMVKKNNTEIPDYNYYDLNSPEGSLPIPEEYIHHYSRKQKMNKGLLST---CCDKK 384 Query 118 --ADREDEVVFSQGDLSWMQRQHEHE-LSADQEPE----VSRESARSSQTGAILTRQQRS 170 + E V F LS +EHE + D+E + +S+E+ + + S Sbjct 385 IVTEEEKNVQFVSVPLS-----NEHESVCVDEEIKKNINMSQENINTQLNNNMDNFIYDS 439 Query 171 DISEG 175 DI + Sbjct 440 DIKKN 444 Lambda K H 0.313 0.130 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40752393066 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40