bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0066_orf1 Length=195 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.288 62.4 7e-09 > 5833.MAL13P1.288 Length=153 Score = 62.4 bits (150), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 41/134 (30%), Positives = 62/134 (46%), Gaps = 10/134 (7%) Query 41 LLCFCICFVYPASLSFQLLLNEKASPSGALKNDHLQHVMF---WILCSWICCIESFPPLA 97 L+ IC + PA ++ LL+N+K + D LQ++ F WIL S+ ES + Sbjct 13 LVNMIICIICPALKTYNLLINKKEKAT----EDTLQYIHFLTYWILYSFYTYFES-AFIV 67 Query 98 LLFQYLPFYYEIKCALFYWLASPQFKGAGWLWLNVINPAYERAAPMCVQMYNERCPPQVK 157 L +PFY E+K F+WL S F+GAG+L+ I Y + + P V Sbjct 68 KLMNVVPFYGELKIMFFFWLYSDTFQGAGYLYFKFIEKHYSIIDKKICDLIQNKIPKNVS 127 Query 158 A--AIEKATAAISS 169 EK+ I + Sbjct 128 NFFYFEKSNKKIHN 141 Lambda K H 0.329 0.138 0.471 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 45508314650 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40