bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0133_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_2020 154 7e-37 > 5807.cgd2_2020 Length=205 Score = 154 bits (389), Expect = 7e-37, Method: Compositional matrix adjust. Identities = 75/139 (53%), Positives = 101/139 (72%), Gaps = 4/139 (2%) Query 6 ARASAIPITKDNVGHIRTGYLARRPEELPVLARWLPA-SVVRHQLHRAKYLDLILYSREQ 64 A+ S + IT +N +I+TGY++RR EE+PVL+RW P S QL ++KYLD+ILYS+EQ Sbjct 65 AKQSIVKITNENEKYIKTGYISRRDEEIPVLSRWFPKDSPPASQLIKSKYLDIILYSKEQ 124 Query 65 IAKENAAMTKS--EVLID-PTNPEWFIVSIKAQDEPFELPMSPITIMRNALIEEGGSGVS 121 KE++ M ++L D NP+W+I+SIKAQ+E FE+PM PITI+RN LIEEGGSGV Sbjct 125 CEKESSIMNCCLQDILDDREKNPDWYIISIKAQNESFEVPMEPITILRNTLIEEGGSGVP 184 Query 122 INREAYARSVEYWSNHVVV 140 + RE Y SVE+W H +V Sbjct 185 LKREKYLESVEFWKEHAIV 203 Lambda K H 0.316 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40