bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0144_orf3 Length=148 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1035w 101 7e-21 > 5833.PFF1035w Length=664 Score = 101 bits (251), Expect = 7e-21, Method: Composition-based stats. Identities = 53/116 (45%), Positives = 73/116 (62%), Gaps = 5/116 (4%) Query 3 KMELEPTVVYRGAVNKPPEYGGELDPISFKLHAIEIHQFVPLPNMEAPEFVKAL-SNGIM 61 K + P++ Y G V+KPP G+LD ISFKLHAIE+HQF+P+P++ P F+ + S Sbjct 446 KSPVNPSIEYLGKVDKPPIDAGKLDSISFKLHAIEVHQFIPVPSLPKPRFLDLVPSQQYE 505 Query 62 TSDVSGLEKFFGGHVPPGWADPDVTGIPATTMSDILSGNAQNVAVMSPLVCQLSSQ 117 +D+S L+ F G VP GW DP +TG A M+D+L GN Q SPL LS++ Sbjct 506 QNDISSLQNVF-GQVPEGWVDPQITGFIAPMMNDVLHGNIQP---QSPLFNNLSTE 557 Lambda K H 0.314 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40