bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0163_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value 10116.ENSRNOP00000009112 125 5e-28 > 10116.ENSRNOP00000009112 Length=513 Score = 125 bits (313), Expect = 5e-28, Method: Composition-based stats. Identities = 55/95 (57%), Positives = 73/95 (76%), Gaps = 3/95 (3%) Query 5 NSIPNCCAFRDEGDRSSLVVGSNNGQLHFWDWRSGYKYQTLQSRVQPGSLESENGIFCCA 64 N+I N A +G LV G++NG +H WDWR+GY +Q + + VQPGSL+SE+GIF CA Sbjct 412 NAIINTLAVNTDG---VLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACA 468 Query 65 FDKSETRLITGECDKTIKIWKIDEEATEETHPISW 99 FD+SE+RL+T E DKTIK+++ DE ATEETHP+SW Sbjct 469 FDRSESRLLTAEADKTIKVYREDETATEETHPVSW 503 Lambda K H 0.317 0.133 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40