bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0186_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0460w 117 8e-26 > 5833.PFI0460w Length=489 Score = 117 bits (294), Expect = 8e-26, Method: Compositional matrix adjust. Identities = 68/145 (46%), Positives = 79/145 (54%), Gaps = 32/145 (22%) Query 6 LPFEANSSYRSDYGAKPLPQVVPPAPVTLPPSLPFEANSAYREEFG-------------- 51 LPFE S+YRSDYG KPLP++ P + LP SLPFE S YR EFG Sbjct 345 LPFEGESNYRSDYGPKPLPELPPRIEMKLPKSLPFEGESNYRSEFGPKPLPELPPKIYMQ 404 Query 52 ------------------PKPLPKQPAPQEVKLPPSLPFEGDTVYRSEYIRKENPVCQVT 93 PKPLP+ P E KL LPFEG++ YR+EYIRK PVC V Sbjct 405 PPKPLPFEGESNYRSEFGPKPLPELPPRHETKLVKQLPFEGESSYRTEYIRKVLPVCPVE 464 Query 94 RMPPYPQPEYPNNHVFWDKNEKTWY 118 +P YP P YP+ HVFWD+ K WY Sbjct 465 LLPKYPTPTYPSQHVFWDRETKKWY 489 Lambda K H 0.312 0.135 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40