bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0187_orf1 Length=217 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL004493-PA 186 5e-46 > 7159.AAEL004493-PA Length=809 Score = 186 bits (472), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 92/204 (45%), Positives = 137/204 (67%), Gaps = 13/204 (6%) Query 2 LLQHETQVAVVHSQLTFCDDQ--PIKSKDPMLMACGFRRFPASPIYSEEPRQGVRSAAKW 59 LL HE Q++V++ L + PIKSK+ +++ CGFRRF +PI+S+ + K Sbjct 585 LLPHEHQMSVMNVCLKRTSNSTIPIKSKERLIVQCGFRRFIVNPIFSQHT-----NGDKH 639 Query 60 KFKRWAEPGSTLTATVYSPLVLPPSPCIMLRSDSSEPD-NLRITAWGSVLPVNGASSRLI 118 K++R+ PG T+ AT ++P+ PP+P + R++ PD +L + A GSV+ N R++ Sbjct 640 KYERYFRPGMTVVATFFAPIQFPPAPVVCFRTN---PDTSLGMVASGSVIDCN--PDRVV 694 Query 119 IKRVLLSGHPFKVHRRKAIVRFMFFNPDDVRWFTPIELHTKRGLRGNIVEPLGTHGYMKC 178 +KR ++SGHPFK+HR+ A++R+MFFNP+D+ +F P +L TK G G+I E LGTHG+MKC Sbjct 695 LKRAVISGHPFKIHRKSAVIRYMFFNPEDIEYFKPCKLRTKLGRLGHIKESLGTHGHMKC 754 Query 179 KFSDHLKQSDEVLLPLYRRVFPKW 202 F LK D VLL LY+RV+PKW Sbjct 755 IFDTQLKSHDTVLLYLYKRVYPKW 778 Lambda K H 0.323 0.138 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 57341003262 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40